Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AB3D65_RS14780 Genome accession   NZ_CP165606
Coordinates   2911798..2911917 (-) Length   39 a.a.
NCBI ID   WP_151295764.1    Uniprot ID   -
Organism   Bacillus velezensis strain BP1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2906798..2916917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3D65_RS14755 (AB3D65_14755) - 2907039..2907797 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  AB3D65_RS14760 (AB3D65_14760) - 2907791..2908738 (-) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  AB3D65_RS14765 (AB3D65_14765) ceuB 2908728..2909681 (-) 954 WP_059366593.1 ABC transporter permease Machinery gene
  AB3D65_RS14770 (AB3D65_14770) - 2910095..2911459 (+) 1365 WP_369547120.1 aspartate kinase -
  AB3D65_RS14775 (AB3D65_14775) - 2911539..2911649 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  AB3D65_RS14780 (AB3D65_14780) phrC 2911798..2911917 (-) 120 WP_151295764.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB3D65_RS14785 (AB3D65_14785) rapC 2911901..2913049 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AB3D65_RS14790 (AB3D65_14790) - 2913202..2914635 (-) 1434 WP_165913860.1 sensor histidine kinase -
  AB3D65_RS14795 (AB3D65_14795) - 2914622..2915305 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4258.98 Da        Isoelectric Point: 8.0285

>NTDB_id=1030820 AB3D65_RS14780 WP_151295764.1 2911798..2911917(-) (phrC) [Bacillus velezensis strain BP1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1030820 AB3D65_RS14780 WP_151295764.1 2911798..2911917(-) (phrC) [Bacillus velezensis strain BP1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment