Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB4K06_RS18675 Genome accession   NZ_CP163458
Coordinates   3525724..3525864 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N33     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3520724..3530864
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB4K06_RS18650 (AB4K06_18650) yuxO 3521037..3521417 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  AB4K06_RS18655 (AB4K06_18655) comA 3521436..3522080 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB4K06_RS18660 (AB4K06_18660) comP 3522161..3524470 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  AB4K06_RS18665 (AB4K06_18665) comX 3524485..3524652 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  AB4K06_RS18670 (AB4K06_18670) comQ 3524640..3525539 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  AB4K06_RS18675 (AB4K06_18675) degQ 3525724..3525864 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB4K06_RS18680 (AB4K06_18680) - 3526086..3526211 (+) 126 WP_003228793.1 hypothetical protein -
  AB4K06_RS18685 (AB4K06_18685) - 3526325..3526693 (+) 369 WP_003243784.1 hypothetical protein -
  AB4K06_RS18690 (AB4K06_18690) pdeH 3526669..3527898 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AB4K06_RS18695 (AB4K06_18695) pncB 3528035..3529507 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AB4K06_RS18700 (AB4K06_18700) pncA 3529523..3530074 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  AB4K06_RS18705 (AB4K06_18705) yueI 3530171..3530569 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1030023 AB4K06_RS18675 WP_003220708.1 3525724..3525864(-) (degQ) [Bacillus subtilis strain N33]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1030023 AB4K06_RS18675 WP_003220708.1 3525724..3525864(-) (degQ) [Bacillus subtilis strain N33]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment