Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   AB4K06_RS18665 Genome accession   NZ_CP163458
Coordinates   3524485..3524652 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain N33     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3519485..3529652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB4K06_RS18635 (AB4K06_18635) mrpE 3519880..3520356 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  AB4K06_RS18640 (AB4K06_18640) mrpF 3520356..3520640 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  AB4K06_RS18645 (AB4K06_18645) mnhG 3520624..3520998 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  AB4K06_RS18650 (AB4K06_18650) yuxO 3521037..3521417 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  AB4K06_RS18655 (AB4K06_18655) comA 3521436..3522080 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB4K06_RS18660 (AB4K06_18660) comP 3522161..3524470 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  AB4K06_RS18665 (AB4K06_18665) comX 3524485..3524652 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  AB4K06_RS18670 (AB4K06_18670) comQ 3524640..3525539 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  AB4K06_RS18675 (AB4K06_18675) degQ 3525724..3525864 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB4K06_RS18680 (AB4K06_18680) - 3526086..3526211 (+) 126 WP_003228793.1 hypothetical protein -
  AB4K06_RS18685 (AB4K06_18685) - 3526325..3526693 (+) 369 WP_003243784.1 hypothetical protein -
  AB4K06_RS18690 (AB4K06_18690) pdeH 3526669..3527898 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AB4K06_RS18695 (AB4K06_18695) pncB 3528035..3529507 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1030021 AB4K06_RS18665 WP_003242801.1 3524485..3524652(-) (comX) [Bacillus subtilis strain N33]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1030021 AB4K06_RS18665 WP_003242801.1 3524485..3524652(-) (comX) [Bacillus subtilis strain N33]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment