Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AB6A33_RS14770 | Genome accession | NZ_CP163446 |
| Coordinates | 2998332..2998472 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain Hao 2023 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993332..3003472
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6A33_RS14745 (AB6A33_14745) | - | 2993678..2994061 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| AB6A33_RS14750 (AB6A33_14750) | comA | 2994083..2994727 (-) | 645 | WP_369265035.1 | response regulator | Regulator |
| AB6A33_RS14755 (AB6A33_14755) | comP | 2994808..2997108 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| AB6A33_RS14760 (AB6A33_14760) | comX | 2997122..2997295 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| AB6A33_RS14765 (AB6A33_14765) | - | 2997264..2998124 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| AB6A33_RS14770 (AB6A33_14770) | degQ | 2998332..2998472 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AB6A33_RS14775 (AB6A33_14775) | - | 2998938..2999279 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| AB6A33_RS14780 (AB6A33_14780) | - | 2999286..3000509 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| AB6A33_RS14785 (AB6A33_14785) | - | 3000639..3002105 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| AB6A33_RS14790 (AB6A33_14790) | - | 3002123..3002674 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| AB6A33_RS14795 (AB6A33_14795) | - | 3002771..3003169 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1029802 AB6A33_RS14770 WP_003152043.1 2998332..2998472(-) (degQ) [Bacillus velezensis strain Hao 2023]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1029802 AB6A33_RS14770 WP_003152043.1 2998332..2998472(-) (degQ) [Bacillus velezensis strain Hao 2023]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |