Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB4922_RS14665 Genome accession   NZ_CP162911
Coordinates   2823512..2823652 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus aerius strain KW1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2818512..2828652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB4922_RS14640 (AB4922_14640) - 2818791..2819180 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  AB4922_RS14645 (AB4922_14645) comA 2819204..2819845 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  AB4922_RS14650 (AB4922_14650) comP 2819926..2822238 (-) 2313 WP_035701206.1 ATP-binding protein Regulator
  AB4922_RS14655 (AB4922_14655) comX 2822279..2822449 (-) 171 WP_074041927.1 competence pheromone ComX -
  AB4922_RS14660 (AB4922_14660) - 2822446..2823360 (-) 915 WP_065460972.1 polyprenyl synthetase family protein -
  AB4922_RS14665 (AB4922_14665) degQ 2823512..2823652 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AB4922_RS14670 (AB4922_14670) - 2824158..2824511 (+) 354 WP_019744042.1 hypothetical protein -
  AB4922_RS14675 (AB4922_14675) - 2824548..2825774 (-) 1227 WP_017358938.1 EAL and HDOD domain-containing protein -
  AB4922_RS14680 (AB4922_14680) - 2825915..2827384 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  AB4922_RS14685 (AB4922_14685) - 2827402..2827953 (-) 552 WP_046526549.1 cysteine hydrolase family protein -
  AB4922_RS14690 (AB4922_14690) - 2828014..2828421 (-) 408 WP_056702629.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1028047 AB4922_RS14665 WP_003213123.1 2823512..2823652(-) (degQ) [Bacillus aerius strain KW1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1028047 AB4922_RS14665 WP_003213123.1 2823512..2823652(-) (degQ) [Bacillus aerius strain KW1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment