Detailed information NTG1027676

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: AB3Z07_RS17915
• Genome accession: NZ_CP162630
• Coordinates: 3633567..3633869 (-)
• Length: 100 a.a.
• NCBI ID: WP_368657390.1
• Uniprot ID: -
• Organism: Metabacillus halosaccharovorans strain Hao 2024
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3628567..3638869

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB3Z07_RS17865 (AB3Z07_17865)	-	3629019..3629759 (-)	741	WP_368657382.1	YveK family protein	-
AB3Z07_RS17870 (AB3Z07_17870)	-	3630172..3630555 (+)	384	WP_368657383.1	helix-turn-helix domain-containing protein	-
AB3Z07_RS17875 (AB3Z07_17875)	-	3630548..3630688 (+)	141	WP_368657384.1	anti-repressor SinI family protein	-
AB3Z07_RS17880 (AB3Z07_17880)	-	3630864..3631178 (+)	315	WP_216774394.1	DUF3889 domain-containing protein	-
AB3Z07_RS17885 (AB3Z07_17885)	-	3631227..3631421 (-)	195	WP_026558772.1	YqzE family protein	-
AB3Z07_RS17890 (AB3Z07_17890)	-	3631457..3631972 (-)	516	WP_368657385.1	shikimate kinase	-
AB3Z07_RS17895 (AB3Z07_17895)	comGG	3632014..3632394 (-)	381	WP_368657386.1	competence type IV pilus minor pilin ComGG	-
AB3Z07_RS17900 (AB3Z07_17900)	comGF	3632391..3632927 (-)	537	WP_368657387.1	competence type IV pilus minor pilin ComGF	-
AB3Z07_RS17905 (AB3Z07_17905)	comGE	3632818..3633165 (-)	348	WP_368657388.1	competence type IV pilus minor pilin ComGE	-
AB3Z07_RS17910 (AB3Z07_17910)	comGD	3633131..3633577 (-)	447	WP_368657389.1	competence type IV pilus minor pilin ComGD	-
AB3Z07_RS17915 (AB3Z07_17915)	comGC	3633567..3633869 (-)	303	WP_368657390.1	competence type IV pilus major pilin ComGC	Machinery gene
AB3Z07_RS17920 (AB3Z07_17920)	comGB	3633879..3634910 (-)	1032	WP_368657391.1	competence type IV pilus assembly protein ComGB	-
AB3Z07_RS17925 (AB3Z07_17925)	comGA	3634903..3635967 (-)	1065	WP_368657392.1	competence type IV pilus ATPase ComGA	Machinery gene
AB3Z07_RS17935 (AB3Z07_17935)	-	3636292..3636672 (-)	381	WP_368657393.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
AB3Z07_RS17940 (AB3Z07_17940)	-	3637022..3637270 (+)	249	WP_026558763.1	DUF2626 domain-containing protein	-
AB3Z07_RS17945 (AB3Z07_17945)	-	3637316..3637948 (-)	633	WP_078432570.1	MBL fold metallo-hydrolase	-
AB3Z07_RS17950 (AB3Z07_17950)	-	3638212..3638385 (+)	174	WP_026558761.1	DUF2759 domain-containing protein	-
AB3Z07_RS17955 (AB3Z07_17955)	-	3638437..3638748 (-)	312	WP_216774424.1	MTH1187 family thiamine-binding protein	-

Sequence

Protein

• Length: 100 a.a.
• Molecular weight: 10993.78 Da
• Isoelectric Point: 5.0207

>NTDB_id=1027676 AB3Z07_RS17915 WP_368657390.1 3633567..3633869(-) (comGC) [Metabacillus halosaccharovorans strain Hao 2024]
MKREKGFTLIEMLIVLLVISVLLLITIPNVTKHNQGIQKKGCEGLINMVQAQATSYHIDNQEIPTMQDLKDNGYLRELPV
CPNGNDVVISSTGEVSEVGS

Nucleotide

• Length: 303 bp

>NTDB_id=1027676 AB3Z07_RS17915 WP_368657390.1 3633567..3633869(-) (comGC) [Metabacillus halosaccharovorans strain Hao 2024]
ATGAAAAGGGAAAAAGGATTTACCTTAATTGAAATGCTGATCGTTTTGCTCGTGATCTCTGTTTTACTGCTTATTACGAT
TCCAAATGTGACAAAACATAATCAAGGGATTCAAAAGAAAGGATGTGAAGGGCTGATTAATATGGTCCAAGCACAAGCTA
CCTCCTATCACATTGATAATCAGGAAATTCCCACAATGCAGGATTTAAAAGATAATGGCTATCTCCGCGAACTCCCGGTT
TGTCCAAATGGAAACGACGTTGTCATATCTTCAACTGGTGAGGTTTCTGAGGTTGGGTCATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-26)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	61.702	94	0.58
comGC	Staphylococcus aureus MW2	39.175	97	0.38
comGC	Staphylococcus aureus N315	39.175	97	0.38