Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB3470_RS13430 Genome accession   NZ_CP162517
Coordinates   2540605..2540778 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BF12B1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2535605..2545778
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3470_RS13415 (AB3470_13415) gcvT 2536405..2537493 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  AB3470_RS13420 (AB3470_13420) hepAA 2537934..2539607 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  AB3470_RS13425 (AB3470_13425) yqhG 2539628..2540422 (+) 795 WP_015714249.1 YqhG family protein -
  AB3470_RS13430 (AB3470_13430) sinI 2540605..2540778 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB3470_RS13435 (AB3470_13435) sinR 2540812..2541147 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB3470_RS13440 (AB3470_13440) tasA 2541240..2542025 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  AB3470_RS13445 (AB3470_13445) sipW 2542089..2542661 (-) 573 WP_072692741.1 signal peptidase I SipW -
  AB3470_RS13450 (AB3470_13450) tapA 2542645..2543406 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  AB3470_RS13455 (AB3470_13455) yqzG 2543678..2544004 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB3470_RS13460 (AB3470_13460) spoIITA 2544046..2544225 (-) 180 WP_029726723.1 YqzE family protein -
  AB3470_RS13465 (AB3470_13465) comGG 2544297..2544671 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  AB3470_RS13470 (AB3470_13470) comGF 2544672..2545055 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  AB3470_RS13475 (AB3470_13475) comGE 2545081..2545428 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1026773 AB3470_RS13430 WP_003230187.1 2540605..2540778(+) (sinI) [Bacillus subtilis strain BF12B1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1026773 AB3470_RS13430 WP_003230187.1 2540605..2540778(+) (sinI) [Bacillus subtilis strain BF12B1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment