Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AB3470_RS13470 Genome accession   NZ_CP162517
Coordinates   2544672..2545055 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain BF12B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2539672..2550055
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3470_RS13430 (AB3470_13430) sinI 2540605..2540778 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB3470_RS13435 (AB3470_13435) sinR 2540812..2541147 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB3470_RS13440 (AB3470_13440) tasA 2541240..2542025 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  AB3470_RS13445 (AB3470_13445) sipW 2542089..2542661 (-) 573 WP_072692741.1 signal peptidase I SipW -
  AB3470_RS13450 (AB3470_13450) tapA 2542645..2543406 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  AB3470_RS13455 (AB3470_13455) yqzG 2543678..2544004 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB3470_RS13460 (AB3470_13460) spoIITA 2544046..2544225 (-) 180 WP_029726723.1 YqzE family protein -
  AB3470_RS13465 (AB3470_13465) comGG 2544297..2544671 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  AB3470_RS13470 (AB3470_13470) comGF 2544672..2545055 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  AB3470_RS13475 (AB3470_13475) comGE 2545081..2545428 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  AB3470_RS13480 (AB3470_13480) comGD 2545412..2545843 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  AB3470_RS13485 (AB3470_13485) comGC 2545833..2546129 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  AB3470_RS13490 (AB3470_13490) comGB 2546143..2547180 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  AB3470_RS13495 (AB3470_13495) comGA 2547167..2548237 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AB3470_RS13500 (AB3470_13500) - 2548450..2548647 (-) 198 WP_029726717.1 hypothetical protein -
  AB3470_RS13505 (AB3470_13505) corA 2548649..2549602 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=1026776 AB3470_RS13470 WP_029726721.1 2544672..2545055(-) (comGF) [Bacillus subtilis strain BF12B1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1026776 AB3470_RS13470 WP_029726721.1 2544672..2545055(-) (comGF) [Bacillus subtilis strain BF12B1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment