Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AB4J90_RS12020 Genome accession   NZ_CP162496
Coordinates   2380926..2381423 (-) Length   165 a.a.
NCBI ID   WP_184321957.1    Uniprot ID   -
Organism   Geobacillus thermodenitrificans strain BIM B-1973     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2337027..2398061 2380926..2381423 within 0


Gene organization within MGE regions


Location: 2337027..2398061
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB4J90_RS11765 (AB4J90_11765) - 2337027..2337347 (-) 321 WP_368492731.1 hypothetical protein -
  AB4J90_RS11770 (AB4J90_11770) - 2337391..2337962 (+) 572 Protein_2257 IS630-like element ISBs2 family transposase -
  AB4J90_RS11775 (AB4J90_11775) - 2338065..2339723 (+) 1659 WP_015863777.1 IS1634 family transposase -
  AB4J90_RS11780 (AB4J90_11780) - 2339815..2340330 (+) 516 WP_368493162.1 IS630 family transposase -
  AB4J90_RS11785 (AB4J90_11785) - 2340593..2343370 (-) 2778 WP_368492732.1 tetratricopeptide repeat protein -
  AB4J90_RS11790 (AB4J90_11790) - 2343812..2343966 (+) 155 Protein_2261 IS982 family transposase -
  AB4J90_RS11795 (AB4J90_11795) - 2344025..2344492 (-) 468 WP_100660614.1 GNAT family N-acetyltransferase -
  AB4J90_RS11800 (AB4J90_11800) - 2344985..2345095 (+) 111 WP_078172638.1 YjcZ family sporulation protein -
  AB4J90_RS11805 (AB4J90_11805) - 2345049..2345498 (-) 450 WP_368492733.1 hypothetical protein -
  AB4J90_RS11810 (AB4J90_11810) - 2346937..2348220 (-) 1284 WP_287136241.1 translation elongation factor -
  AB4J90_RS11815 (AB4J90_11815) - 2348204..2349046 (-) 843 WP_287136240.1 DNA adenine methylase -
  AB4J90_RS11820 (AB4J90_11820) - 2349318..2350487 (+) 1170 WP_190300653.1 IS256 family transposase -
  AB4J90_RS11825 (AB4J90_11825) - 2350744..2351466 (-) 723 WP_368492734.1 N-acetylmuramoyl-L-alanine amidase -
  AB4J90_RS11830 (AB4J90_11830) - 2351515..2351997 (-) 483 WP_368492735.1 hypothetical protein -
  AB4J90_RS11835 (AB4J90_11835) - 2352200..2352706 (-) 507 WP_368492736.1 hypothetical protein -
  AB4J90_RS11840 (AB4J90_11840) - 2352812..2353171 (-) 360 WP_368492737.1 hypothetical protein -
  AB4J90_RS11845 (AB4J90_11845) - 2353192..2353377 (-) 186 WP_081207180.1 hypothetical protein -
  AB4J90_RS11850 (AB4J90_11850) - 2353377..2353727 (-) 351 WP_033020079.1 hypothetical protein -
  AB4J90_RS11855 (AB4J90_11855) - 2353742..2356633 (-) 2892 WP_368492738.1 glycosyl hydrolase family 18 protein -
  AB4J90_RS11860 (AB4J90_11860) - 2356630..2357427 (-) 798 WP_368492739.1 hypothetical protein -
  AB4J90_RS11865 (AB4J90_11865) - 2357432..2357629 (-) 198 WP_079936618.1 hypothetical protein -
  AB4J90_RS11870 (AB4J90_11870) - 2357626..2359119 (-) 1494 WP_368492740.1 phage tail spike protein -
  AB4J90_RS11875 (AB4J90_11875) - 2359130..2360194 (-) 1065 WP_171355565.1 hypothetical protein -
  AB4J90_RS11880 (AB4J90_11880) - 2360210..2360959 (-) 750 WP_011888052.1 distal tail protein Dit -
  AB4J90_RS11885 (AB4J90_11885) - 2360956..2362395 (-) 1440 WP_238381367.1 hypothetical protein -
  AB4J90_RS11890 (AB4J90_11890) - 2362766..2363548 (-) 783 WP_081157449.1 HNH endonuclease -
  AB4J90_RS11895 (AB4J90_11895) - 2363659..2364792 (-) 1134 WP_368492741.1 tape measure protein -
  AB4J90_RS11900 (AB4J90_11900) - 2364983..2365411 (-) 429 WP_008881956.1 hypothetical protein -
  AB4J90_RS11905 (AB4J90_11905) - 2365432..2365602 (-) 171 WP_008881957.1 hypothetical protein -
  AB4J90_RS11910 (AB4J90_11910) - 2365651..2366601 (-) 951 WP_081157446.1 phage tail tube protein -
  AB4J90_RS11915 (AB4J90_11915) - 2366622..2367041 (-) 420 WP_008881959.1 hypothetical protein -
  AB4J90_RS11920 (AB4J90_11920) - 2367070..2367513 (-) 444 WP_008881960.1 hypothetical protein -
  AB4J90_RS11925 (AB4J90_11925) - 2367510..2367935 (-) 426 WP_368492742.1 HK97 gp10 family phage protein -
  AB4J90_RS11930 (AB4J90_11930) - 2367941..2368366 (-) 426 WP_368492743.1 hypothetical protein -
  AB4J90_RS11935 (AB4J90_11935) - 2368373..2368732 (-) 360 WP_368492744.1 hypothetical protein -
  AB4J90_RS11940 (AB4J90_11940) - 2368747..2369700 (-) 954 WP_368493163.1 phage major capsid protein -
  AB4J90_RS11945 (AB4J90_11945) - 2369697..2371127 (-) 1431 WP_368492745.1 XkdF-like putative serine protease domain-containing protein -
  AB4J90_RS11950 (AB4J90_11950) - 2371194..2372060 (-) 867 WP_368492746.1 phage minor head protein -
  AB4J90_RS11955 (AB4J90_11955) - 2372053..2373501 (-) 1449 WP_368492747.1 phage portal protein -
  AB4J90_RS11960 (AB4J90_11960) terL 2373520..2374911 (-) 1392 WP_368493164.1 phage terminase large subunit -
  AB4J90_RS11965 (AB4J90_11965) - 2374886..2375419 (-) 534 WP_368492748.1 hypothetical protein -
  AB4J90_RS11970 (AB4J90_11970) - 2375484..2375846 (-) 363 WP_013144090.1 DUF2513 domain-containing protein -
  AB4J90_RS11975 (AB4J90_11975) - 2376649..2376819 (-) 171 WP_008880443.1 hypothetical protein -
  AB4J90_RS11980 (AB4J90_11980) - 2376841..2378124 (-) 1284 WP_368492749.1 Clp protease ClpP -
  AB4J90_RS11985 (AB4J90_11985) - 2378121..2378273 (-) 153 WP_368492750.1 hypothetical protein -
  AB4J90_RS11990 (AB4J90_11990) - 2378303..2378731 (-) 429 WP_368492751.1 helix-turn-helix domain-containing protein -
  AB4J90_RS11995 (AB4J90_11995) - 2378773..2379195 (-) 423 WP_013144083.1 hypothetical protein -
  AB4J90_RS12000 (AB4J90_12000) - 2379208..2379699 (-) 492 WP_008881975.1 hypothetical protein -
  AB4J90_RS12005 (AB4J90_12005) - 2379713..2380261 (-) 549 WP_184321959.1 dUTP diphosphatase -
  AB4J90_RS12010 (AB4J90_12010) - 2380280..2380462 (-) 183 WP_095859868.1 hypothetical protein -
  AB4J90_RS12015 (AB4J90_12015) - 2380554..2380907 (-) 354 WP_368492752.1 hypothetical protein -
  AB4J90_RS12020 (AB4J90_12020) ssb 2380926..2381423 (-) 498 WP_184321957.1 single-stranded DNA-binding protein Machinery gene
  AB4J90_RS12025 (AB4J90_12025) - 2381513..2381971 (-) 459 WP_184321956.1 HNH endonuclease -
  AB4J90_RS12030 (AB4J90_12030) - 2381968..2382396 (-) 429 WP_011888084.1 hypothetical protein -
  AB4J90_RS12035 (AB4J90_12035) - 2382401..2383648 (-) 1248 WP_368492753.1 replicative DNA helicase -
  AB4J90_RS12040 (AB4J90_12040) - 2383645..2383908 (-) 264 WP_008881985.1 replicative helicase loader/inhibitor -
  AB4J90_RS12045 (AB4J90_12045) - 2383924..2384745 (-) 822 WP_008881986.1 DnaD domain protein -
  AB4J90_RS12050 (AB4J90_12050) - 2384993..2385154 (-) 162 WP_008881988.1 hypothetical protein -
  AB4J90_RS12055 (AB4J90_12055) - 2385151..2385852 (-) 702 WP_008881989.1 ERF family protein -
  AB4J90_RS12060 (AB4J90_12060) - 2385849..2386325 (-) 477 WP_008881990.1 siphovirus Gp157 family protein -
  AB4J90_RS12065 (AB4J90_12065) - 2386349..2386543 (-) 195 WP_008881991.1 hypothetical protein -
  AB4J90_RS12070 (AB4J90_12070) - 2387076..2387348 (-) 273 WP_099233427.1 hypothetical protein -
  AB4J90_RS12075 (AB4J90_12075) - 2387320..2387568 (-) 249 WP_099233617.1 DUF771 domain-containing protein -
  AB4J90_RS12080 (AB4J90_12080) - 2387614..2387748 (-) 135 WP_008881994.1 hypothetical protein -
  AB4J90_RS12085 (AB4J90_12085) - 2387764..2388498 (-) 735 WP_368492754.1 BRO family protein -
  AB4J90_RS12090 (AB4J90_12090) - 2388513..2388749 (-) 237 WP_328191415.1 helix-turn-helix transcriptional regulator -
  AB4J90_RS12095 (AB4J90_12095) - 2388893..2389360 (+) 468 WP_368492755.1 helix-turn-helix domain-containing protein -
  AB4J90_RS12100 (AB4J90_12100) - 2389382..2389816 (+) 435 WP_008881998.1 ImmA/IrrE family metallo-endopeptidase -
  AB4J90_RS12105 (AB4J90_12105) - 2389858..2390991 (+) 1134 WP_368492756.1 tyrosine-type recombinase/integrase -
  AB4J90_RS12140 (AB4J90_12140) - 2397263..2397553 (+) 291 WP_008879552.1 hypothetical protein -
  AB4J90_RS12145 (AB4J90_12145) - 2397618..2398061 (+) 444 WP_008879553.1 Hsp20/alpha crystallin family protein -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 18917.06 Da        Isoelectric Point: 6.4480

>NTDB_id=1026523 AB4J90_RS12020 WP_184321957.1 2380926..2381423(-) (ssb) [Geobacillus thermodenitrificans strain BIM B-1973]
MINRVILTGRLTDDPQFRYTPSGVAVVTFTLAVTRPFANQNGVREADFIRCVAWRKQAENIANYLKKGSMVGIDGRLETG
SYERNGRRTYYTQVVVDTATFLEPRNASNSGRKQRGDRDTFEQEKNASRKAREAFMKPPEEQRWFDDPFADNGEPIEIND
DDLPF

Nucleotide


Download         Length: 498 bp        

>NTDB_id=1026523 AB4J90_RS12020 WP_184321957.1 2380926..2381423(-) (ssb) [Geobacillus thermodenitrificans strain BIM B-1973]
ATGATTAACCGCGTCATTTTGACAGGACGACTGACGGACGATCCGCAGTTTCGATATACGCCAAGCGGAGTGGCTGTTGT
CACATTCACACTGGCCGTTACCCGTCCGTTTGCGAATCAAAACGGGGTGCGGGAAGCTGATTTTATTCGTTGCGTCGCAT
GGCGAAAACAGGCAGAGAACATCGCAAACTACTTGAAGAAAGGAAGTATGGTCGGGATCGACGGGCGATTGGAAACGGGC
AGCTATGAACGGAACGGACGGAGGACGTATTATACACAGGTCGTGGTGGATACGGCAACATTTCTGGAGCCGCGCAACGC
TTCGAATTCGGGCAGGAAACAGAGAGGGGATAGGGACACATTCGAACAAGAGAAAAACGCCTCTAGGAAAGCGAGAGAAG
CGTTTATGAAGCCGCCAGAAGAGCAGAGATGGTTTGATGATCCTTTTGCTGATAACGGGGAGCCGATCGAAATAAACGAT
GACGATTTGCCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

50.867

100

0.533
  ssbA Bacillus subtilis subsp. subtilis str. 168

50.581

100

0.527

Multiple sequence alignment