Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB2M34_RS09255 Genome accession   NZ_CP161903
Coordinates   1735770..1735943 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain DYJ24     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1730770..1740943
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB2M34_RS09210 (AB2M34_09210) comGE 1731119..1731466 (+) 348 WP_087614620.1 ComG operon protein 5 Machinery gene
  AB2M34_RS09215 (AB2M34_09215) comGF 1731492..1731875 (+) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  AB2M34_RS09220 (AB2M34_09220) comGG 1731876..1732250 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AB2M34_RS09225 (AB2M34_09225) spoIITA 1732322..1732501 (+) 180 WP_029726723.1 YqzE family protein -
  AB2M34_RS09230 (AB2M34_09230) yqzG 1732543..1732869 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB2M34_RS09235 (AB2M34_09235) tapA 1733141..1733902 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AB2M34_RS09240 (AB2M34_09240) sipW 1733886..1734458 (+) 573 WP_129134142.1 signal peptidase I SipW -
  AB2M34_RS09245 (AB2M34_09245) tasA 1734523..1735308 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  AB2M34_RS09250 (AB2M34_09250) sinR 1735401..1735736 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB2M34_RS09255 (AB2M34_09255) sinI 1735770..1735943 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB2M34_RS09260 (AB2M34_09260) yqhG 1736126..1736920 (-) 795 WP_014480249.1 YqhG family protein -
  AB2M34_RS09265 (AB2M34_09265) hepAA 1736941..1738614 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  AB2M34_RS09270 (AB2M34_09270) gcvT 1739056..1740144 (+) 1089 WP_129134000.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1023072 AB2M34_RS09255 WP_003230187.1 1735770..1735943(-) (sinI) [Bacillus subtilis strain DYJ24]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1023072 AB2M34_RS09255 WP_003230187.1 1735770..1735943(-) (sinI) [Bacillus subtilis strain DYJ24]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment