Detailed information NTG1020671

Bioinformatically predicted

Overview

• Name: rcrR
• Type: Regulator
• Locus tag: AB1F71_RS04310
• Genome accession: NZ_CP160386
• Coordinates: 873264..873698 (+)
• Length: 144 a.a.
• NCBI ID: WP_002263292.1
• Uniprot ID: A0AAX1K4B8
• Organism: Streptococcus mutans strain UA159 ykuR deletion
• Function: regulate competence (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	854430..877248	873264..873698	within	0

Gene organization within MGE regions

Location: 854430..877248

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB1F71_RS04245 (AB1F71_04245)	-	854430..855635 (+)	1206	WP_002262894.1	CCA tRNA nucleotidyltransferase	-
AB1F71_RS04250 (AB1F71_04250)	-	855638..857506 (+)	1869	WP_002262895.1	ABC-F family ATP-binding cassette domain-containing protein	-
AB1F71_RS04255 (AB1F71_04255)	-	857963..859699 (+)	1737	WP_002262897.1	ABC transporter ATP-binding protein	-
AB1F71_RS04260 (AB1F71_04260)	-	859710..861482 (+)	1773	WP_002262898.1	ABC transporter ATP-binding protein	-
AB1F71_RS04265 (AB1F71_04265)	-	861598..862518 (+)	921	WP_002262899.1	AEC family transporter	-
AB1F71_RS04270 (AB1F71_04270)	gtfD	862738..867126 (+)	4389	WP_002352262.1	glucosyltransferase-S	-
AB1F71_RS04275 (AB1F71_04275)	-	867301..867810 (-)	510	WP_002262901.1	DUF308 domain-containing protein	-
AB1F71_RS04280 (AB1F71_04280)	gdhA	868446..869795 (+)	1350	WP_002263849.1	NADP-specific glutamate dehydrogenase	-
AB1F71_RS04285 (AB1F71_04285)	-	869907..870290 (-)	384	WP_002263287.1	DUF3021 family protein	-
AB1F71_RS04290 (AB1F71_04290)	queF	870399..870887 (-)	489	WP_002263288.1	preQ(1) synthase	-
AB1F71_RS04295 (AB1F71_04295)	queE	870900..871616 (-)	717	WP_002263289.1	7-carboxy-7-deazaguanine synthase QueE	-
AB1F71_RS04300 (AB1F71_04300)	queD	871613..872059 (-)	447	WP_002263290.1	6-carboxytetrahydropterin synthase QueD	-
AB1F71_RS04305 (AB1F71_04305)	queC	872059..872712 (-)	654	WP_002263291.1	7-cyano-7-deazaguanine synthase QueC	-
AB1F71_RS04310 (AB1F71_04310)	rcrR	873264..873698 (+)	435	WP_002263292.1	MarR family winged helix-turn-helix transcriptional regulator	Regulator
AB1F71_RS04315 (AB1F71_04315)	rcrP	873702..875504 (+)	1803	WP_002263293.1	ATP-binding cassette domain-containing protein	Regulator
AB1F71_RS04320 (AB1F71_04320)	rcrQ	875494..877248 (+)	1755	WP_002263294.1	ABC transporter ATP-binding protein	Regulator

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16720.58 Da
• Isoelectric Point: 10.5126

>NTDB_id=1020671 AB1F71_RS04310 WP_002263292.1 873264..873698(+) (rcrR) [Streptococcus mutans strain UA159 ykuR deletion]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide

• Length: 435 bp

>NTDB_id=1020671 AB1F71_RS04310 WP_002263292.1 873264..873698(+) (rcrR) [Streptococcus mutans strain UA159 ykuR deletion]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

• MarR family (MarR_2) (31-89)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
rcrR	Streptococcus mutans UA159	100	100	1