Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB   Type   Regulator
Locus tag   ABVF41_RS08810 Genome accession   NZ_CP160385
Coordinates   1786713..1787726 (+) Length   337 a.a.
NCBI ID   WP_002263739.1    Uniprot ID   Q8DSA7
Organism   Streptococcus mutans strain UA159-WCSS     
Function   transport of ComC (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1741478..1820870 1786713..1787726 within 0


Gene organization within MGE regions


Location: 1741478..1820870
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABVF41_RS08590 (ABVF41_08590) - 1741609..1743048 (+) 1440 WP_002262658.1 sucrose-6-phosphate hydrolase -
  ABVF41_RS08595 (ABVF41_08595) - 1743051..1744013 (+) 963 WP_002262659.1 LacI family DNA-binding transcriptional regulator -
  ABVF41_RS08600 (ABVF41_08600) nusB 1744207..1744635 (-) 429 WP_002262660.1 transcription antitermination factor NusB -
  ABVF41_RS08605 (ABVF41_08605) - 1744628..1745017 (-) 390 WP_002262661.1 Asp23/Gls24 family envelope stress response protein -
  ABVF41_RS08610 (ABVF41_08610) efp 1745060..1745620 (-) 561 WP_002262662.1 elongation factor P -
  ABVF41_RS08615 (ABVF41_08615) - 1745760..1746464 (+) 705 WP_002262663.1 ion transporter -
  ABVF41_RS08620 (ABVF41_08620) - 1746512..1746964 (-) 453 WP_002262664.1 deaminase -
  ABVF41_RS08625 (ABVF41_08625) - 1747134..1748198 (-) 1065 WP_002262665.1 Xaa-Pro peptidase family protein -
  ABVF41_RS08630 (ABVF41_08630) uvrA 1748188..1751019 (-) 2832 WP_002262666.1 excinuclease ABC subunit UvrA -
  ABVF41_RS08635 (ABVF41_08635) - 1751069..1751290 (+) 222 WP_019313410.1 hypothetical protein -
  ABVF41_RS08640 (ABVF41_08640) - 1751690..1752634 (+) 945 WP_002262667.1 magnesium transporter CorA family protein -
  ABVF41_RS08645 (ABVF41_08645) - 1752916..1753578 (+) 663 WP_002262668.1 DUF1129 domain-containing protein -
  ABVF41_RS08650 (ABVF41_08650) hdrR 1753717..1754073 (+) 357 WP_002262669.1 LytTR family transcriptional regulator HdrR Regulator
  ABVF41_RS08655 (ABVF41_08655) hdrM 1754070..1754756 (+) 687 WP_002262670.1 hdrR negative regulator HdrM Regulator
  ABVF41_RS08660 (ABVF41_08660) - 1754764..1755483 (-) 720 WP_002262671.1 TraX family protein -
  ABVF41_RS08665 (ABVF41_08665) rpsR 1755802..1756041 (-) 240 WP_000068664.1 30S ribosomal protein S18 -
  ABVF41_RS08670 (ABVF41_08670) ssbA 1756070..1756564 (-) 495 WP_002261867.1 single-stranded DNA-binding protein Machinery gene
  ABVF41_RS08675 (ABVF41_08675) rpsF 1756582..1756872 (-) 291 WP_002261866.1 30S ribosomal protein S6 -
  ABVF41_RS08680 (ABVF41_08680) - 1757028..1757273 (-) 246 WP_002263367.1 hypothetical protein -
  ABVF41_RS08685 (ABVF41_08685) - 1757578..1757781 (+) 204 WP_002263366.1 hypothetical protein -
  ABVF41_RS08690 (ABVF41_08690) mutY 1758818..1759963 (+) 1146 WP_002263365.1 A/G-specific adenine glycosylase -
  ABVF41_RS08695 (ABVF41_08695) - 1760151..1761200 (-) 1050 WP_002263364.1 zinc-dependent alcohol dehydrogenase family protein -
  ABVF41_RS08700 (ABVF41_08700) trxA 1761298..1761612 (-) 315 WP_002263363.1 thioredoxin -
  ABVF41_RS08705 (ABVF41_08705) - 1761687..1764017 (-) 2331 WP_002263362.1 endonuclease MutS2 -
  ABVF41_RS08710 (ABVF41_08710) - 1764086..1764631 (-) 546 WP_002263361.1 CvpA family protein -
  ABVF41_RS08715 (ABVF41_08715) - 1764628..1764933 (-) 306 WP_002263360.1 hypothetical protein -
  ABVF41_RS08720 (ABVF41_08720) rnhC 1765129..1766040 (+) 912 WP_002271343.1 ribonuclease HIII -
  ABVF41_RS08725 (ABVF41_08725) lepB 1766060..1766647 (+) 588 WP_002263358.1 signal peptidase I -
  ABVF41_RS08730 (ABVF41_08730) - 1766733..1769096 (+) 2364 WP_002263357.1 ATP-dependent RecD-like DNA helicase -
  ABVF41_RS08735 (ABVF41_08735) - 1769195..1769665 (+) 471 WP_002263356.1 hypothetical protein -
  ABVF41_RS08740 (ABVF41_08740) - 1770542..1771534 (+) 993 WP_002263355.1 PTS sugar transporter subunit IIB -
  ABVF41_RS08745 (ABVF41_08745) - 1771569..1772387 (+) 819 WP_002263354.1 PTS mannose/fructose/sorbose transporter subunit IIC -
  ABVF41_RS08750 (ABVF41_08750) - 1772402..1773328 (+) 927 WP_002263353.1 PTS system mannose/fructose/sorbose family transporter subunit IID -
  ABVF41_RS08755 (ABVF41_08755) comA/nlmT 1773660..1775951 (-) 2292 WP_002263352.1 peptide cleavage/export ABC transporter Regulator
  ABVF41_RS08760 (ABVF41_08760) - 1776501..1776854 (-) 354 WP_002263351.1 hypothetical protein -
  ABVF41_RS08765 (ABVF41_08765) - 1777173..1777541 (+) 369 WP_002263350.1 DUF956 family protein -
  ABVF41_RS08770 (ABVF41_08770) - 1777778..1778851 (-) 1074 WP_002263349.1 acyltransferase -
  ABVF41_RS08775 (ABVF41_08775) serS 1779375..1780655 (+) 1281 WP_002263348.1 serine--tRNA ligase -
  ABVF41_RS08780 (ABVF41_08780) - 1781338..1781601 (-) 264 WP_002352361.1 Blp family class II bacteriocin -
  ABVF41_RS08785 (ABVF41_08785) - 1781905..1782090 (-) 186 WP_002263346.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  ABVF41_RS08795 (ABVF41_08795) - 1783667..1783828 (-) 162 WP_002263734.1 Blp family class II bacteriocin -
  ABVF41_RS08800 (ABVF41_08800) - 1783873..1784127 (-) 255 WP_002263733.1 Blp family class II bacteriocin -
  ABVF41_RS08805 (ABVF41_08805) - 1784515..1786700 (+) 2186 Protein_1687 peptide cleavage/export ABC transporter -
  ABVF41_RS08810 (ABVF41_08810) comB 1786713..1787726 (+) 1014 WP_002263739.1 HlyD family efflux transporter periplasmic adaptor subunit Regulator
  ABVF41_RS08815 (ABVF41_08815) - 1787988..1788131 (-) 144 WP_002263740.1 hypothetical protein -
  ABVF41_RS08820 (ABVF41_08820) - 1788198..1788350 (-) 153 WP_002263741.1 hypothetical protein -
  ABVF41_RS08825 (ABVF41_08825) - 1788423..1789445 (-) 1023 WP_002263742.1 thioredoxin family protein -
  ABVF41_RS08830 (ABVF41_08830) - 1789931..1790119 (-) 189 WP_002263743.1 Blp family class II bacteriocin -
  ABVF41_RS08835 (ABVF41_08835) - 1790283..1790495 (-) 213 WP_002263744.1 Blp family class II bacteriocin -
  ABVF41_RS08840 (ABVF41_08840) - 1790900..1791064 (-) 165 WP_002265308.1 hypothetical protein -
  ABVF41_RS08845 (ABVF41_08845) - 1791504..1791716 (+) 213 Protein_1695 IS3 family transposase -
  ABVF41_RS08850 (ABVF41_08850) - 1791839..1792243 (-) 405 WP_002263912.1 hypothetical protein -
  ABVF41_RS08855 (ABVF41_08855) - 1792390..1792809 (-) 420 WP_002263913.1 hypothetical protein -
  ABVF41_RS08860 (ABVF41_08860) - 1794190..1794591 (-) 402 WP_002310604.1 hypothetical protein -
  ABVF41_RS08865 (ABVF41_08865) cipB 1794722..1794952 (-) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  ABVF41_RS08870 (ABVF41_08870) comC/blpC 1795219..1795359 (+) 141 WP_002267610.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  ABVF41_RS08875 (ABVF41_08875) comD/blpH 1795501..1796826 (-) 1326 WP_002262113.1 GHKL domain-containing protein Regulator
  ABVF41_RS08880 (ABVF41_08880) comE/blpR 1796823..1797575 (-) 753 WP_002262114.1 response regulator transcription factor Regulator
  ABVF41_RS08885 (ABVF41_08885) - 1798047..1798685 (-) 639 WP_002262115.1 VTT domain-containing protein -
  ABVF41_RS08890 (ABVF41_08890) - 1798732..1799358 (-) 627 WP_002262116.1 hypothetical protein -
  ABVF41_RS08895 (ABVF41_08895) der 1799433..1800743 (-) 1311 WP_002262117.1 ribosome biogenesis GTPase Der -
  ABVF41_RS08900 (ABVF41_08900) dnaI 1800756..1801655 (-) 900 WP_002262118.1 primosomal protein DnaI -
  ABVF41_RS08905 (ABVF41_08905) - 1801656..1802825 (-) 1170 WP_002262119.1 DnaD domain protein -
  ABVF41_RS08910 (ABVF41_08910) nrdR 1802812..1803303 (-) 492 WP_002262120.1 transcriptional regulator NrdR -
  ABVF41_RS08915 (ABVF41_08915) covR 1803673..1804365 (-) 693 WP_002262121.1 response regulator GcrR Regulator
  ABVF41_RS08920 (ABVF41_08920) - 1804722..1805258 (-) 537 WP_002262122.1 YceD family protein -
  ABVF41_RS08925 (ABVF41_08925) - 1805251..1805826 (-) 576 WP_002262123.1 TetR/AcrR family transcriptional regulator -
  ABVF41_RS08930 (ABVF41_08930) - 1805934..1806641 (+) 708 WP_002262124.1 ABC transporter ATP-binding protein -
  ABVF41_RS08935 (ABVF41_08935) - 1806643..1809255 (+) 2613 WP_002263841.1 ABC transporter permease -
  ABVF41_RS08940 (ABVF41_08940) htpX 1809392..1810291 (-) 900 WP_002262126.1 zinc metalloprotease HtpX -
  ABVF41_RS08945 (ABVF41_08945) - 1810301..1810861 (-) 561 WP_002262127.1 LemA family protein -
  ABVF41_RS08950 (ABVF41_08950) rsmG 1810949..1811662 (+) 714 WP_002262128.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -
  ABVF41_RS08955 (ABVF41_08955) - 1811886..1812719 (-) 834 WP_002262129.1 energy-coupling factor transporter transmembrane protein EcfT -
  ABVF41_RS08960 (ABVF41_08960) - 1812712..1814388 (-) 1677 WP_002262130.1 ABC transporter ATP-binding protein -
  ABVF41_RS08965 (ABVF41_08965) - 1814417..1814962 (-) 546 WP_002262131.1 ECF-type riboflavin transporter substrate-binding protein -
  ABVF41_RS08970 (ABVF41_08970) - 1814972..1815817 (-) 846 WP_002262132.1 S-adenosyl-l-methionine hydroxide adenosyltransferase family protein -
  ABVF41_RS08975 (ABVF41_08975) - 1815941..1816717 (-) 777 WP_002262133.1 carbon-nitrogen family hydrolase -
  ABVF41_RS08980 (ABVF41_08980) - 1816785..1817474 (-) 690 WP_002262134.1 methionine ABC transporter permease -
  ABVF41_RS08985 (ABVF41_08985) - 1817476..1818540 (-) 1065 WP_002262135.1 methionine ABC transporter ATP-binding protein -
  ABVF41_RS08990 (ABVF41_08990) - 1818533..1819906 (-) 1374 WP_002262136.1 M20/M25/M40 family metallo-hydrolase -

Sequence


Protein


Download         Length: 337 a.a.        Molecular weight: 38498.13 Da        Isoelectric Point: 10.7202

>NTDB_id=1020622 ABVF41_RS08810 WP_002263739.1 1786713..1787726(+) (comB) [Streptococcus mutans strain UA159-WCSS]
MNPNLFKSAEFYRRRYHNFATVLIIPLVCLLVFLFIFLLFAKKEVTVLSDGEISPIKVIDVIQSKSDYPISENNLTDNHA
VKKRDVLIQYVNPAANTRQGGNNQNQNQSQNKQNKNQQQNNKNQKNGNQGQKNQNQNQNKKDQKNNNQSQQNKQGQKKTN
QSQNQQNKNQNKNQSQNKQNGNQNQNNWNQNNQNDKVTASQDGVIHTNPKYEGENLIPRGTEIAQLYPDINKTRQVLITY
YVSSKDVTRLKQGQKTHLALTKVGNDQISIRGKINSIASAATTTKKGNVFKVTAKAKVSKKDSQTIKYGLQGKTITVVEK
KTFFDYYKDKLLNKNQK

Nucleotide


Download         Length: 1014 bp        

>NTDB_id=1020622 ABVF41_RS08810 WP_002263739.1 1786713..1787726(+) (comB) [Streptococcus mutans strain UA159-WCSS]
ATGAACCCAAATTTATTTAAAAGCGCTGAATTCTACCGAAGACGCTATCATAATTTTGCTACAGTTCTTATTATTCCTTT
GGTTTGTTTACTTGTATTTTTATTTATCTTTCTATTATTTGCTAAAAAAGAGGTCACTGTCTTGTCTGATGGCGAGATCT
CTCCCATTAAAGTAATTGATGTTATTCAATCTAAAAGTGATTATCCCATTTCTGAAAATAATTTAACAGATAATCACGCC
GTTAAAAAAAGGGATGTTCTCATCCAATATGTTAATCCAGCAGCAAATACAAGACAGGGCGGAAATAATCAGAATCAAAA
TCAATCTCAAAACAAGCAAAATAAGAATCAGCAGCAAAACAATAAGAATCAAAAAAACGGCAATCAAGGTCAAAAAAATC
AAAATCAGAACCAAAATAAAAAGGATCAGAAAAACAATAACCAATCTCAGCAAAACAAGCAAGGACAAAAGAAAACTAAT
CAATCCCAAAATCAGCAGAATAAGAATCAAAATAAAAACCAATCTCAAAACAAACAAAATGGGAATCAAAACCAAAATAA
CTGGAATCAGAATAATCAAAATGATAAAGTCACAGCCAGCCAAGATGGTGTTATCCATACCAACCCCAAATATGAAGGTG
AAAACTTAATTCCTCGGGGGACTGAAATCGCACAGCTCTATCCAGATATTAACAAAACAAGACAAGTTCTGATCACTTAT
TACGTCTCCTCTAAAGATGTCACCCGCCTCAAACAAGGCCAAAAGACTCATCTTGCTTTAACCAAGGTAGGAAATGATCA
AATTTCCATTAGAGGAAAAATTAATAGTATCGCTTCAGCTGCTACAACGACGAAAAAAGGCAATGTTTTTAAAGTGACAG
CTAAAGCAAAAGTTTCTAAAAAAGACAGCCAAACCATTAAATACGGCCTCCAGGGTAAAACCATCACAGTTGTTGAAAAA
AAGACTTTCTTTGATTATTATAAAGATAAACTGTTAAATAAAAATCAAAAATAA

Domains


Predicted by InterproScan.

(196-309)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DSA7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB Streptococcus mutans UA159

100

100

1

  comB/nlmE Streptococcus mutans UA159

50.299

99.11

0.499


Multiple sequence alignment