Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R75_RS14565 Genome accession   NZ_CP160232
Coordinates   2842848..2842988 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain JJ1622     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2837848..2847988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R75_RS14540 (AB0R75_14540) - 2838170..2838559 (-) 390 WP_211064043.1 hotdog fold thioesterase -
  AB0R75_RS14545 (AB0R75_14545) comA 2838583..2839224 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  AB0R75_RS14550 (AB0R75_14550) comP 2839305..2841611 (-) 2307 WP_211064042.1 ATP-binding protein Regulator
  AB0R75_RS14555 (AB0R75_14555) comX 2841625..2841804 (-) 180 WP_313960228.1 competence pheromone ComX -
  AB0R75_RS14560 (AB0R75_14560) - 2841773..2842696 (-) 924 WP_144522309.1 polyprenyl synthetase family protein -
  AB0R75_RS14565 (AB0R75_14565) degQ 2842848..2842988 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AB0R75_RS14570 (AB0R75_14570) - 2843536..2843847 (+) 312 WP_213019770.1 inner spore coat protein -
  AB0R75_RS14575 (AB0R75_14575) - 2843879..2845105 (-) 1227 WP_211064153.1 EAL and HDOD domain-containing protein -
  AB0R75_RS14580 (AB0R75_14580) - 2845245..2846714 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  AB0R75_RS14585 (AB0R75_14585) - 2846732..2847283 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  AB0R75_RS14590 (AB0R75_14590) - 2847344..2847751 (-) 408 WP_144522307.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1020283 AB0R75_RS14565 WP_003213123.1 2842848..2842988(-) (degQ) [Bacillus pumilus strain JJ1622]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1020283 AB0R75_RS14565 WP_003213123.1 2842848..2842988(-) (degQ) [Bacillus pumilus strain JJ1622]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment