Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R72_RS16710 Genome accession   NZ_CP160229
Coordinates   3359729..3359869 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain AP46     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3354729..3364869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R72_RS16685 (AB0R72_16690) - 3355025..3355408 (-) 384 WP_327942488.1 hotdog fold thioesterase -
  AB0R72_RS16690 (AB0R72_16695) comA 3355430..3356074 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R72_RS16695 (AB0R72_16700) comP 3356155..3358464 (-) 2310 WP_033574914.1 histidine kinase Regulator
  AB0R72_RS16700 (AB0R72_16705) comX 3358484..3358660 (-) 177 WP_007408675.1 competence pheromone ComX -
  AB0R72_RS16705 (AB0R72_16710) comQ 3358660..3359544 (-) 885 WP_061862640.1 class 1 isoprenoid biosynthesis enzyme Regulator
  AB0R72_RS16710 (AB0R72_16715) degQ 3359729..3359869 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R72_RS16715 (AB0R72_16720) - 3360332..3360673 (+) 342 WP_007408677.1 hypothetical protein -
  AB0R72_RS16720 (AB0R72_16725) - 3360680..3361903 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R72_RS16725 (AB0R72_16730) - 3362033..3363499 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AB0R72_RS16730 (AB0R72_16735) - 3363517..3364068 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AB0R72_RS16735 (AB0R72_16740) - 3364165..3364563 (-) 399 WP_061862533.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1020221 AB0R72_RS16710 WP_003152043.1 3359729..3359869(-) (degQ) [Bacillus velezensis strain AP46]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1020221 AB0R72_RS16710 WP_003152043.1 3359729..3359869(-) (degQ) [Bacillus velezensis strain AP46]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment