Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AB0R86_RS02335 Genome accession   NZ_CP160227
Coordinates   459154..459273 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain JJ947     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 454154..464273
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R86_RS02310 (AB0R86_02310) - 454396..455154 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  AB0R86_RS02315 (AB0R86_02315) - 455148..456095 (-) 948 WP_335394966.1 iron chelate uptake ABC transporter family permease subunit -
  AB0R86_RS02320 (AB0R86_02320) ceuB 456085..457038 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  AB0R86_RS02325 (AB0R86_02325) - 457452..458816 (+) 1365 WP_042634827.1 aspartate kinase -
  AB0R86_RS02330 (AB0R86_02330) - 458911..459006 (+) 96 WP_021495118.1 YjcZ family sporulation protein -
  AB0R86_RS02335 (AB0R86_02335) phrC 459154..459273 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB0R86_RS02340 (AB0R86_02340) rapC 459257..460405 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AB0R86_RS02345 (AB0R86_02345) - 460558..461991 (-) 1434 WP_335394969.1 HAMP domain-containing sensor histidine kinase -
  AB0R86_RS02350 (AB0R86_02350) - 461978..462661 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1020094 AB0R86_RS02335 WP_003156334.1 459154..459273(-) (phrC) [Bacillus velezensis strain JJ947]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1020094 AB0R86_RS02335 WP_003156334.1 459154..459273(-) (phrC) [Bacillus velezensis strain JJ947]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment