Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R87_RS14850 Genome accession   NZ_CP160224
Coordinates   2890038..2890178 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain JJ950     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2885038..2895178
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R87_RS14825 (AB0R87_14825) - 2885324..2885713 (-) 390 WP_340866485.1 hotdog fold thioesterase -
  AB0R87_RS14830 (AB0R87_14830) comA 2885737..2886378 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  AB0R87_RS14835 (AB0R87_14835) comP 2886459..2888771 (-) 2313 WP_340866486.1 ATP-binding protein Regulator
  AB0R87_RS14840 (AB0R87_14840) comX 2888805..2888975 (-) 171 WP_212045489.1 competence pheromone ComX -
  AB0R87_RS14845 (AB0R87_14845) - 2888972..2889886 (-) 915 WP_366596300.1 polyprenyl synthetase family protein -
  AB0R87_RS14850 (AB0R87_14850) degQ 2890038..2890178 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AB0R87_RS14855 (AB0R87_14855) - 2890684..2891037 (+) 354 WP_212045491.1 inner spore coat protein -
  AB0R87_RS14860 (AB0R87_14860) - 2891068..2892294 (-) 1227 WP_212045764.1 EAL and HDOD domain-containing protein -
  AB0R87_RS14865 (AB0R87_14865) - 2892435..2893904 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  AB0R87_RS14870 (AB0R87_14870) - 2893922..2894473 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  AB0R87_RS14875 (AB0R87_14875) - 2894534..2894941 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1019933 AB0R87_RS14850 WP_003213123.1 2890038..2890178(-) (degQ) [Bacillus pumilus strain JJ950]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019933 AB0R87_RS14850 WP_003213123.1 2890038..2890178(-) (degQ) [Bacillus pumilus strain JJ950]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment