Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AB0R89_RS01990 Genome accession   NZ_CP160218
Coordinates   392226..392345 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP45     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 387226..397345
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R89_RS01975 (AB0R89_01975) - 388838..389521 (+) 684 WP_007410267.1 response regulator transcription factor -
  AB0R89_RS01980 (AB0R89_01980) - 389508..390935 (+) 1428 WP_162533087.1 HAMP domain-containing sensor histidine kinase -
  AB0R89_RS01985 (AB0R89_01985) rapC 391094..392242 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AB0R89_RS01990 (AB0R89_01990) phrC 392226..392345 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB0R89_RS01995 (AB0R89_01995) - 392493..392588 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  AB0R89_RS02000 (AB0R89_02000) - 392683..394047 (-) 1365 WP_043021400.1 aspartate kinase -
  AB0R89_RS02005 (AB0R89_02005) ceuB 394461..395414 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  AB0R89_RS02010 (AB0R89_02010) - 395404..396351 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  AB0R89_RS02015 (AB0R89_02015) - 396345..397103 (+) 759 WP_043021401.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=1019514 AB0R89_RS01990 WP_033575081.1 392226..392345(+) (phrC) [Bacillus velezensis strain AP45]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1019514 AB0R89_RS01990 WP_033575081.1 392226..392345(+) (phrC) [Bacillus velezensis strain AP45]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment