Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R74_RS14755 Genome accession   NZ_CP160216
Coordinates   3002177..3002317 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JJ1043     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2997177..3007317
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R74_RS14730 (AB0R74_14730) - 2997523..2997906 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  AB0R74_RS14735 (AB0R74_14735) comA 2997928..2998572 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R74_RS14740 (AB0R74_14740) comP 2998653..3000953 (-) 2301 WP_032867184.1 histidine kinase Regulator
  AB0R74_RS14745 (AB0R74_14745) comX 3000967..3001140 (-) 174 WP_012118314.1 competence pheromone ComX -
  AB0R74_RS14750 (AB0R74_14750) - 3001109..3001969 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  AB0R74_RS14755 (AB0R74_14755) degQ 3002177..3002317 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R74_RS14760 (AB0R74_14760) - 3002782..3003123 (+) 342 WP_069006914.1 hypothetical protein -
  AB0R74_RS14765 (AB0R74_14765) - 3003130..3004353 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R74_RS14770 (AB0R74_14770) - 3004483..3005949 (-) 1467 WP_139134428.1 nicotinate phosphoribosyltransferase -
  AB0R74_RS14775 (AB0R74_14775) - 3005967..3006518 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AB0R74_RS14780 (AB0R74_14780) - 3006615..3007013 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1019413 AB0R74_RS14755 WP_003152043.1 3002177..3002317(-) (degQ) [Bacillus velezensis strain JJ1043]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019413 AB0R74_RS14755 WP_003152043.1 3002177..3002317(-) (degQ) [Bacillus velezensis strain JJ1043]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment