Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R81_RS14960 Genome accession   NZ_CP160215
Coordinates   3046342..3046482 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JJ213     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3041342..3051482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R81_RS14935 (AB0R81_14935) - 3041669..3042052 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  AB0R81_RS14940 (AB0R81_14940) comA 3042074..3042718 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R81_RS14945 (AB0R81_14945) comP 3042799..3045105 (-) 2307 WP_094032817.1 sensor histidine kinase Regulator
  AB0R81_RS14950 (AB0R81_14950) comX 3045124..3045300 (-) 177 WP_015240484.1 competence pheromone ComX -
  AB0R81_RS14955 (AB0R81_14955) - 3045315..3046190 (-) 876 WP_366573181.1 polyprenyl synthetase family protein -
  AB0R81_RS14960 (AB0R81_14960) degQ 3046342..3046482 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R81_RS14965 (AB0R81_14965) - 3046948..3047289 (+) 342 WP_007613435.1 hypothetical protein -
  AB0R81_RS14970 (AB0R81_14970) - 3047296..3048519 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R81_RS14975 (AB0R81_14975) - 3048649..3050115 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  AB0R81_RS14980 (AB0R81_14980) - 3050133..3050684 (-) 552 WP_025285193.1 isochorismatase family cysteine hydrolase -
  AB0R81_RS14985 (AB0R81_14985) - 3050781..3051179 (-) 399 WP_122504167.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1019337 AB0R81_RS14960 WP_003152043.1 3046342..3046482(-) (degQ) [Bacillus velezensis strain JJ213]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019337 AB0R81_RS14960 WP_003152043.1 3046342..3046482(-) (degQ) [Bacillus velezensis strain JJ213]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment