Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AB0R81_RS02010 Genome accession   NZ_CP160215
Coordinates   395754..395873 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ213     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 390754..400873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R81_RS01995 (AB0R81_01995) - 392366..393049 (+) 684 WP_007410267.1 response regulator transcription factor -
  AB0R81_RS02000 (AB0R81_02000) - 393036..394469 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  AB0R81_RS02005 (AB0R81_02005) rapC 394622..395770 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AB0R81_RS02010 (AB0R81_02010) phrC 395754..395873 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB0R81_RS02015 (AB0R81_02015) - 396021..396116 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  AB0R81_RS02020 (AB0R81_02020) - 396211..397575 (-) 1365 WP_059366589.1 aspartate kinase -
  AB0R81_RS02025 (AB0R81_02025) ceuB 397989..398942 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  AB0R81_RS02030 (AB0R81_02030) - 398932..399879 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  AB0R81_RS02035 (AB0R81_02035) - 399873..400631 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=1019286 AB0R81_RS02010 WP_033575081.1 395754..395873(+) (phrC) [Bacillus velezensis strain JJ213]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1019286 AB0R81_RS02010 WP_033575081.1 395754..395873(+) (phrC) [Bacillus velezensis strain JJ213]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment