Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R66_RS12930 | Genome accession | NZ_CP160214 |
| Coordinates | 2675063..2675236 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ747 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2670063..2680236
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R66_RS12915 (AB0R66_12915) | gcvT | 2670876..2671976 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R66_RS12920 (AB0R66_12920) | - | 2672400..2674070 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| AB0R66_RS12925 (AB0R66_12925) | - | 2674092..2674886 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| AB0R66_RS12930 (AB0R66_12930) | sinI | 2675063..2675236 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R66_RS12935 (AB0R66_12935) | sinR | 2675270..2675605 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R66_RS12940 (AB0R66_12940) | tasA | 2675653..2676438 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R66_RS12945 (AB0R66_12945) | sipW | 2676503..2677087 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| AB0R66_RS12950 (AB0R66_12950) | tapA | 2677059..2677730 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R66_RS12955 (AB0R66_12955) | - | 2677989..2678318 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R66_RS12960 (AB0R66_12960) | - | 2678358..2678537 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R66_RS12965 (AB0R66_12965) | comGG | 2678594..2678971 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R66_RS12970 (AB0R66_12970) | comGF | 2678972..2679472 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R66_RS12975 (AB0R66_12975) | comGE | 2679381..2679695 (-) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R66_RS12980 (AB0R66_12980) | comGD | 2679679..2680116 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019240 AB0R66_RS12930 WP_003153105.1 2675063..2675236(+) (sinI) [Bacillus velezensis strain JJ747]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019240 AB0R66_RS12930 WP_003153105.1 2675063..2675236(+) (sinI) [Bacillus velezensis strain JJ747]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |