Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB0R70_RS11925 Genome accession   NZ_CP160212
Coordinates   2472783..2473160 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain JM204     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2467783..2478160
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R70_RS11885 (AB0R70_11885) - 2468280..2469074 (+) 795 WP_136396493.1 YqhG family protein -
  AB0R70_RS11890 (AB0R70_11890) sinI 2469251..2469424 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R70_RS11895 (AB0R70_11895) sinR 2469458..2469793 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R70_RS11900 (AB0R70_11900) tasA 2469841..2470626 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R70_RS11905 (AB0R70_11905) sipW 2470691..2471263 (-) 573 WP_136396777.1 signal peptidase I SipW -
  AB0R70_RS11910 (AB0R70_11910) tapA 2471247..2471918 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R70_RS11915 (AB0R70_11915) - 2472177..2472506 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB0R70_RS11920 (AB0R70_11920) - 2472547..2472726 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R70_RS11925 (AB0R70_11925) comGG 2472783..2473160 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R70_RS11930 (AB0R70_11930) comGF 2473161..2473661 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  AB0R70_RS11935 (AB0R70_11935) comGE 2473570..2473884 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB0R70_RS11940 (AB0R70_11940) comGD 2473868..2474305 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R70_RS11945 (AB0R70_11945) comGC 2474295..2474603 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R70_RS11950 (AB0R70_11950) comGB 2474608..2475645 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R70_RS11955 (AB0R70_11955) comGA 2475632..2476702 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R70_RS11960 (AB0R70_11960) - 2476896..2477846 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1019092 AB0R70_RS11925 WP_012117980.1 2472783..2473160(-) (comGG) [Bacillus velezensis strain JM204]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1019092 AB0R70_RS11925 WP_012117980.1 2472783..2473160(-) (comGG) [Bacillus velezensis strain JM204]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment