Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB0R71_RS14910 Genome accession   NZ_CP160210
Coordinates   3031864..3032004 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JM907     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3026864..3037004
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R71_RS14885 (AB0R71_14880) - 3027204..3027587 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  AB0R71_RS14890 (AB0R71_14885) comA 3027609..3028253 (-) 645 WP_377863099.1 response regulator Regulator
  AB0R71_RS14895 (AB0R71_14890) comP 3028334..3030625 (-) 2292 WP_160223246.1 histidine kinase Regulator
  AB0R71_RS14900 (AB0R71_14895) comX 3030637..3030801 (-) 165 WP_061581461.1 competence pheromone ComX -
  AB0R71_RS14905 (AB0R71_14900) - 3030801..3031712 (-) 912 WP_081111611.1 polyprenyl synthetase family protein -
  AB0R71_RS14910 (AB0R71_14905) degQ 3031864..3032004 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R71_RS14915 (AB0R71_14910) - 3032469..3032810 (+) 342 WP_069006914.1 hypothetical protein -
  AB0R71_RS14920 (AB0R71_14915) - 3032817..3034040 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R71_RS14925 (AB0R71_14920) - 3034170..3035636 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  AB0R71_RS14930 (AB0R71_14925) - 3035654..3036205 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  AB0R71_RS14935 (AB0R71_14930) - 3036301..3036699 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1018959 AB0R71_RS14910 WP_003152043.1 3031864..3032004(-) (degQ) [Bacillus velezensis strain JM907]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1018959 AB0R71_RS14910 WP_003152043.1 3031864..3032004(-) (degQ) [Bacillus velezensis strain JM907]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment