Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ABZU04_RS00495 Genome accession   NZ_CP160084
Coordinates   100152..100604 (+) Length   150 a.a.
NCBI ID   WP_006588665.1    Uniprot ID   -
Organism   Lactobacillus jensenii strain 188_F1_4     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 93288..131505 100152..100604 within 0


Gene organization within MGE regions


Location: 93288..131505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABZU04_RS00435 (ABZU04_00435) - 93288..94439 (-) 1152 WP_006588676.1 site-specific integrase -
  ABZU04_RS00440 (ABZU04_00440) - 94501..94644 (+) 144 WP_155104730.1 hypothetical protein -
  ABZU04_RS00445 (ABZU04_00445) - 94662..94835 (-) 174 WP_155104729.1 hypothetical protein -
  ABZU04_RS00450 (ABZU04_00450) - 95497..95916 (-) 420 WP_006588674.1 ImmA/IrrE family metallo-endopeptidase -
  ABZU04_RS00455 (ABZU04_00455) - 95949..96260 (-) 312 WP_006588673.1 helix-turn-helix domain-containing protein -
  ABZU04_RS00460 (ABZU04_00460) - 96412..96603 (+) 192 WP_155104727.1 helix-turn-helix transcriptional regulator -
  ABZU04_RS00465 (ABZU04_00465) - 96634..97404 (+) 771 WP_006588671.1 phage repressor protein/antirepressor Ant -
  ABZU04_RS00470 (ABZU04_00470) - 97587..97808 (+) 222 WP_006588670.1 hypothetical protein -
  ABZU04_RS00475 (ABZU04_00475) - 97862..98140 (+) 279 WP_230455761.1 DUF771 domain-containing protein -
  ABZU04_RS00480 (ABZU04_00480) - 98317..98793 (+) 477 WP_006588668.1 siphovirus Gp157 family protein -
  ABZU04_RS00485 (ABZU04_00485) - 98803..99501 (+) 699 WP_006588667.1 ERF family protein -
  ABZU04_RS00490 (ABZU04_00490) - 99517..100155 (+) 639 WP_006588666.1 hypothetical protein -
  ABZU04_RS00495 (ABZU04_00495) ssb 100152..100604 (+) 453 WP_006588665.1 single-stranded DNA-binding protein Machinery gene
  ABZU04_RS00500 (ABZU04_00500) - 100614..101501 (+) 888 WP_240399521.1 hypothetical protein -
  ABZU04_RS00505 (ABZU04_00505) - 101479..101886 (+) 408 WP_006588663.1 RusA family crossover junction endodeoxyribonuclease -
  ABZU04_RS00510 (ABZU04_00510) - 101889..102122 (+) 234 WP_006588662.1 hypothetical protein -
  ABZU04_RS00515 (ABZU04_00515) - 102125..102733 (+) 609 WP_006588661.1 hypothetical protein -
  ABZU04_RS00520 (ABZU04_00520) - 102900..103082 (+) 183 WP_034535625.1 hypothetical protein -
  ABZU04_RS00525 (ABZU04_00525) - 103073..103237 (+) 165 WP_006588659.1 hypothetical protein -
  ABZU04_RS00530 (ABZU04_00530) - 103234..103380 (+) 147 WP_234979512.1 hypothetical protein -
  ABZU04_RS00535 (ABZU04_00535) - 103390..103554 (+) 165 WP_006588657.1 hypothetical protein -
  ABZU04_RS00540 (ABZU04_00540) - 103592..104044 (+) 453 WP_006588656.1 ArpU family phage packaging/lysis transcriptional regulator -
  ABZU04_RS00545 (ABZU04_00545) - 104580..104783 (+) 204 WP_034535624.1 hypothetical protein -
  ABZU04_RS00550 (ABZU04_00550) - 104902..105279 (+) 378 WP_006588654.1 DUF2335 domain-containing protein -
  ABZU04_RS00555 (ABZU04_00555) - 105322..105840 (+) 519 WP_006588653.1 hypothetical protein -
  ABZU04_RS00560 (ABZU04_00560) - 105779..107005 (+) 1227 WP_006588652.1 PBSX family phage terminase large subunit -
  ABZU04_RS00565 (ABZU04_00565) - 107007..108452 (+) 1446 WP_006588651.1 phage portal protein -
  ABZU04_RS00570 (ABZU04_00570) - 108433..109974 (+) 1542 WP_006588650.1 ADP-ribosyltransferase -
  ABZU04_RS00575 (ABZU04_00575) - 109967..110173 (+) 207 WP_006588649.1 hypothetical protein -
  ABZU04_RS00580 (ABZU04_00580) - 110309..110884 (+) 576 WP_230455760.1 DUF4355 domain-containing protein -
  ABZU04_RS00585 (ABZU04_00585) - 110898..111779 (+) 882 WP_006588647.1 hypothetical protein -
  ABZU04_RS00590 (ABZU04_00590) - 111925..112293 (+) 369 WP_034535622.1 phage head-tail connector protein -
  ABZU04_RS00595 (ABZU04_00595) - 112283..112621 (+) 339 WP_048587877.1 hypothetical protein -
  ABZU04_RS00600 (ABZU04_00600) - 112611..113003 (+) 393 WP_006588644.1 HK97 gp10 family phage protein -
  ABZU04_RS00605 (ABZU04_00605) - 113000..113380 (+) 381 WP_006588643.1 hypothetical protein -
  ABZU04_RS00610 (ABZU04_00610) - 113394..113972 (+) 579 WP_006588642.1 phage major tail protein, TP901-1 family -
  ABZU04_RS00615 (ABZU04_00615) - 114031..114360 (+) 330 WP_006588641.1 tail assembly chaperone -
  ABZU04_RS00620 (ABZU04_00620) - 114459..114794 (+) 336 WP_006588640.1 hypothetical protein -
  ABZU04_RS00625 (ABZU04_00625) - 114797..118273 (+) 3477 WP_048587876.1 phage tail tape measure protein -
  ABZU04_RS00630 (ABZU04_00630) - 118277..119089 (+) 813 WP_006588638.1 distal tail protein Dit -
  ABZU04_RS00635 (ABZU04_00635) - 119086..120879 (+) 1794 WP_006588637.1 phage tail spike protein -
  ABZU04_RS00640 (ABZU04_00640) - 120879..121094 (+) 216 WP_006588636.1 hypothetical protein -
  ABZU04_RS00645 (ABZU04_00645) - 121073..123685 (+) 2613 WP_240400243.1 BppU family phage baseplate upper protein -
  ABZU04_RS00650 (ABZU04_00650) - 123734..124216 (+) 483 WP_006588634.1 hypothetical protein -
  ABZU04_RS00655 (ABZU04_00655) - 124228..124401 (+) 174 WP_006588633.1 XkdX family protein -
  ABZU04_RS00660 (ABZU04_00660) - 124454..124795 (+) 342 WP_048587874.1 hypothetical protein -
  ABZU04_RS00665 (ABZU04_00665) - 124810..125106 (+) 297 WP_006588631.1 hypothetical protein -
  ABZU04_RS00670 (ABZU04_00670) - 125099..125263 (+) 165 WP_155403110.1 hypothetical protein -
  ABZU04_RS00675 (ABZU04_00675) - 125247..125669 (+) 423 WP_240398787.1 phage holin -
  ABZU04_RS00680 (ABZU04_00680) - 125679..126794 (+) 1116 WP_048587873.1 GH25 family lysozyme -
  ABZU04_RS00695 (ABZU04_00695) - 127252..128259 (+) 1008 WP_006588375.1 serine hydrolase -
  ABZU04_RS00700 (ABZU04_00700) - 128289..129644 (-) 1356 WP_006584489.1 Mur ligase family protein -
  ABZU04_RS00705 (ABZU04_00705) - 129783..130388 (+) 606 WP_006588374.1 thymidine kinase -
  ABZU04_RS00710 (ABZU04_00710) prfA 130417..131505 (+) 1089 WP_006584491.1 peptide chain release factor 1 -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 16191.04 Da        Isoelectric Point: 5.1479

>NTDB_id=1017811 ABZU04_RS00495 WP_006588665.1 100152..100604(+) (ssb) [Lactobacillus jensenii strain 188_F1_4]
MINRTVLVGRLTKDPDLRVTSSGISVATFTLAVDRKFGSDKNGADFISCVAWRKAGELISQYTHKGSPLAIDGRLQTRTY
DDKDGKRVYVTEVIVDNFTLLGSKSDNQSQGPAPATTNQPPVPTQTSTNTQDPFADVGNALDISADDLPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=1017811 ABZU04_RS00495 WP_006588665.1 100152..100604(+) (ssb) [Lactobacillus jensenii strain 188_F1_4]
ATGATTAATAGAACTGTATTAGTTGGTCGTTTGACTAAAGACCCAGATTTAAGAGTTACGTCAAGTGGCATATCAGTTGC
TACTTTTACGCTAGCAGTTGATAGAAAGTTTGGCAGTGATAAGAATGGCGCTGATTTTATCAGCTGTGTAGCTTGGAGAA
AAGCAGGTGAGCTAATTTCCCAGTACACACATAAAGGTAGCCCACTTGCAATTGATGGTCGACTTCAAACTAGAACTTAT
GACGATAAAGATGGTAAGCGAGTTTATGTAACAGAAGTTATTGTTGATAACTTTACATTGCTTGGCAGTAAATCAGATAA
CCAAAGTCAAGGACCAGCTCCAGCAACTACCAATCAACCACCAGTTCCAACGCAAACCTCAACTAATACACAAGATCCAT
TTGCTGATGTTGGCAATGCACTTGATATTAGTGCAGATGACTTACCGTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-100)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

50

100

0.58
  ssbA Bacillus subtilis subsp. subtilis str. 168

44.186

100

0.507

Multiple sequence alignment