Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | ABXV02_RS09170 | Genome accession | NZ_CP159912 |
| Coordinates | 1727360..1727770 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain PY79 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1680914..1744061 | 1727360..1727770 | within | 0 |
Gene organization within MGE regions
Location: 1680914..1744061
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABXV02_RS08840 | sknR | 1680914..1681264 (-) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| ABXV02_RS08845 | yqaF | 1681441..1681671 (+) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| ABXV02_RS08850 | - | 1681701..1681841 (+) | 141 | WP_003229902.1 | hypothetical protein | - |
| ABXV02_RS08855 | yqaG | 1681915..1682484 (+) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| ABXV02_RS08860 | sknH | 1682481..1682738 (+) | 258 | WP_003245994.1 | YqaH family protein | - |
| ABXV02_RS08865 | - | 1682735..1682908 (+) | 174 | WP_119123069.1 | hypothetical protein | - |
| ABXV02_RS08870 | - | 1682868..1683062 (+) | 195 | WP_003229905.1 | hypothetical protein | - |
| ABXV02_RS08875 | yqaJ | 1683168..1684127 (+) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| ABXV02_RS08880 | recT | 1684130..1684984 (+) | 855 | WP_003229907.1 | recombinase RecT | - |
| ABXV02_RS08885 | yqaL | 1685060..1685737 (+) | 678 | WP_010886575.1 | DnaD domain protein | - |
| ABXV02_RS08890 | sknM | 1685619..1686560 (+) | 942 | WP_075058863.1 | ATP-binding protein | - |
| ABXV02_RS08895 | - | 1686551..1686700 (+) | 150 | WP_003229910.1 | hypothetical protein | - |
| ABXV02_RS08900 | yqaN | 1686796..1687224 (+) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABXV02_RS08905 | yqaO | 1687306..1687512 (+) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| ABXV02_RS08910 | - | 1687586..1688515 (-) | 930 | WP_003229913.1 | hypothetical protein | - |
| ABXV02_RS08915 | yqaQ | 1688713..1689168 (+) | 456 | WP_004398775.1 | hypothetical protein | - |
| ABXV02_RS08920 | - | 1689312..1689776 (+) | 465 | WP_004398685.1 | hypothetical protein | - |
| ABXV02_RS08925 | terS | 1689844..1690563 (+) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| ABXV02_RS08930 | stmB | 1690556..1691851 (+) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| ABXV02_RS08935 | yqbA | 1691855..1693387 (+) | 1533 | WP_004398894.1 | phage portal protein | - |
| ABXV02_RS08940 | yqbB | 1693384..1694301 (+) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| ABXV02_RS08945 | - | 1694342..1694995 (+) | 654 | WP_003229920.1 | hypothetical protein | - |
| ABXV02_RS08950 | yqbD | 1695028..1695996 (+) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| ABXV02_RS08955 | skdG | 1696015..1696950 (+) | 936 | WP_003229922.1 | phage major capsid protein | - |
| ABXV02_RS08960 | yqbF | 1696961..1697272 (+) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| ABXV02_RS08965 | gkpG | 1697276..1697671 (+) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| ABXV02_RS08970 | yqbH | 1697668..1698030 (+) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| ABXV02_RS08975 | yqbI | 1698027..1698530 (+) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| ABXV02_RS08980 | yqbJ | 1698543..1698980 (+) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| ABXV02_RS08985 | - | 1698977..1699168 (+) | 192 | WP_010886574.1 | hypothetical protein | - |
| ABXV02_RS08990 | yqbK | 1699169..1700569 (+) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| ABXV02_RS08995 | yqbM | 1700572..1701015 (+) | 444 | WP_003229930.1 | phage tail tube protein | - |
| ABXV02_RS09000 | bsrH | 1701269..1701358 (-) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| ABXV02_RS09005 | txpA | 1701738..1701917 (-) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| ABXV02_RS09010 | - | 1702063..1702512 (+) | 450 | WP_003229933.1 | phage portal protein | - |
| ABXV02_RS09015 | - | 1702554..1702691 (+) | 138 | WP_003229934.1 | hypothetical protein | - |
| ABXV02_RS09020 | yqbO | 1702694..1707451 (+) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| ABXV02_RS09025 | yqbP | 1707444..1708103 (+) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ABXV02_RS09030 | yqbQ | 1708116..1709096 (+) | 981 | WP_004398524.1 | hypothetical protein | - |
| ABXV02_RS09035 | yqbR | 1709093..1709356 (+) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| ABXV02_RS09040 | yqbS | 1709369..1709794 (+) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| ABXV02_RS09045 | yqbT | 1709787..1710833 (+) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| ABXV02_RS09050 | yqcA | 1710817..1711395 (+) | 579 | WP_003229941.1 | YmfQ family protein | - |
| ABXV02_RS09055 | - | 1711392..1711664 (+) | 273 | WP_003229942.1 | hypothetical protein | - |
| ABXV02_RS09060 | yqcC | 1711667..1712767 (+) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| ABXV02_RS09065 | yqcD | 1712777..1713112 (+) | 336 | WP_009967793.1 | XkdW family protein | - |
| ABXV02_RS09070 | yqcE | 1713109..1713273 (+) | 165 | WP_003229944.1 | XkdX family protein | - |
| ABXV02_RS09075 | xepAK | 1713361..1714254 (+) | 894 | WP_003246010.1 | hypothetical protein | - |
| ABXV02_RS09080 | skhD | 1714299..1714721 (+) | 423 | WP_003246208.1 | holin family protein | - |
| ABXV02_RS09085 | cwlA | 1714766..1715584 (+) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| ABXV02_RS09090 | - | 1715749..1716228 (+) | 480 | WP_004399085.1 | hypothetical protein | - |
| ABXV02_RS09095 | - | 1716244..1716606 (+) | 363 | WP_003229947.1 | hypothetical protein | - |
| ABXV02_RS09100 | - | 1716603..1716749 (-) | 147 | WP_009967791.1 | hypothetical protein | - |
| ABXV02_RS09105 | yqcF | 1716867..1717445 (-) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| ABXV02_RS09110 | yqcG | 1717460..1719055 (-) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| ABXV02_RS09115 | - | 1719425..1719583 (-) | 159 | WP_003245945.1 | hypothetical protein | - |
| ABXV02_RS09120 | phrE | 1719693..1719827 (-) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| ABXV02_RS09125 | rapE | 1719817..1720944 (-) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| ABXV02_RS09130 | yqcI | 1721387..1722151 (+) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| ABXV02_RS09135 | arsR | 1722523..1722840 (+) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| ABXV02_RS09140 | arsK | 1722901..1723341 (+) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| ABXV02_RS09145 | acr3 | 1723364..1724404 (+) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| ABXV02_RS09150 | arsC | 1724416..1724835 (+) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| ABXV02_RS09155 | - | 1725190..1725368 (+) | 179 | Protein_1772 | hypothetical protein | - |
| ABXV02_RS09160 | spoIVCA | 1725326..1726786 (+) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| ABXV02_RS09165 | - | 1726817..1727164 (-) | 348 | Protein_1774 | sigma-70 family RNA polymerase sigma factor | - |
| ABXV02_RS09170 | nucA/comI | 1727360..1727770 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| ABXV02_RS09175 | yqeB | 1727803..1728525 (-) | 723 | WP_010886572.1 | hypothetical protein | - |
| ABXV02_RS09180 | gnd | 1728777..1729670 (+) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| ABXV02_RS09185 | yqeD | 1729689..1730315 (-) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| ABXV02_RS09190 | cwlH | 1730502..1731254 (+) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| ABXV02_RS09195 | yqeF | 1731506..1732237 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| ABXV02_RS09200 | - | 1732543..1732683 (-) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| ABXV02_RS09205 | yqeG | 1733045..1733563 (+) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| ABXV02_RS09210 | yqeH | 1733567..1734667 (+) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| ABXV02_RS09215 | aroE | 1734685..1735527 (+) | 843 | WP_003229967.1 | shikimate dehydrogenase | - |
| ABXV02_RS09220 | yhbY | 1735521..1735811 (+) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| ABXV02_RS09225 | nadD | 1735823..1736392 (+) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| ABXV02_RS09230 | yqeK | 1736382..1736942 (+) | 561 | WP_004399059.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| ABXV02_RS09235 | rsfS | 1736960..1737316 (+) | 357 | WP_003229971.1 | ribosome silencing factor | - |
| ABXV02_RS09240 | yqeM | 1737313..1738056 (+) | 744 | WP_003229973.1 | class I SAM-dependent methyltransferase | - |
| ABXV02_RS09245 | comER | 1738122..1738943 (-) | 822 | WP_004398597.1 | late competence protein ComER | - |
| ABXV02_RS09250 | comEA | 1739027..1739644 (+) | 618 | WP_004398514.1 | competence protein ComEA | Machinery gene |
| ABXV02_RS09255 | comEB | 1739711..1740280 (+) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| ABXV02_RS09260 | comEC | 1740284..1742614 (+) | 2331 | WP_009967776.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| ABXV02_RS09265 | yqzM | 1742654..1742788 (-) | 135 | WP_003229983.1 | YqzM family protein | - |
| ABXV02_RS09270 | - | 1742829..1742978 (+) | 150 | WP_003229985.1 | hypothetical protein | - |
| ABXV02_RS09275 | holA | 1743018..1744061 (+) | 1044 | WP_003229987.1 | DNA polymerase III subunit delta | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=1016735 ABXV02_RS09170 WP_009967785.1 1727360..1727770(+) (nucA/comI) [Bacillus subtilis strain PY79]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=1016735 ABXV02_RS09170 WP_009967785.1 1727360..1727770(+) (nucA/comI) [Bacillus subtilis strain PY79]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |