Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABYM97_RS15985 Genome accession   NZ_CP159874
Coordinates   3107835..3108008 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain PY79     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3102835..3113008
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABYM97_RS15970 (ABYM97_15970) gcvT 3103634..3104722 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  ABYM97_RS15975 (ABYM97_15975) hepAA 3105164..3106837 (+) 1674 WP_004398544.1 SNF2-related protein -
  ABYM97_RS15980 (ABYM97_15980) yqhG 3106858..3107652 (+) 795 WP_003230200.1 YqhG family protein -
  ABYM97_RS15985 (ABYM97_15985) sinI 3107835..3108008 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ABYM97_RS15990 (ABYM97_15990) sinR 3108042..3108377 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABYM97_RS15995 (ABYM97_15995) tasA 3108470..3109255 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ABYM97_RS16000 (ABYM97_16000) sipW 3109319..3109891 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ABYM97_RS16005 (ABYM97_16005) tapA 3109875..3110636 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ABYM97_RS16010 (ABYM97_16010) yqzG 3110908..3111234 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABYM97_RS16015 (ABYM97_16015) spoIITA 3111276..3111455 (-) 180 WP_003230176.1 YqzE family protein -
  ABYM97_RS16020 (ABYM97_16020) comGG 3111526..3111900 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABYM97_RS16025 (ABYM97_16025) comGF 3111901..3112284 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABYM97_RS16030 (ABYM97_16030) comGE 3112310..3112657 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1016384 ABYM97_RS15985 WP_003230187.1 3107835..3108008(+) (sinI) [Bacillus subtilis strain PY79]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1016384 ABYM97_RS15985 WP_003230187.1 3107835..3108008(+) (sinI) [Bacillus subtilis strain PY79]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment