Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABNX04_RS14995 Genome accession   NZ_CP159868
Coordinates   3090378..3090518 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JLU-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3085378..3095518
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABNX04_RS14970 (ABNX04_14970) - 3085718..3086101 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ABNX04_RS14975 (ABNX04_14975) comA 3086123..3086767 (-) 645 WP_354664729.1 response regulator transcription factor Regulator
  ABNX04_RS14980 (ABNX04_14980) comP 3086848..3089139 (-) 2292 WP_038459663.1 histidine kinase Regulator
  ABNX04_RS14985 (ABNX04_14985) comX 3089151..3089315 (-) 165 WP_007613432.1 competence pheromone ComX -
  ABNX04_RS14990 (ABNX04_14990) - 3089315..3090193 (-) 879 WP_038460875.1 polyprenyl synthetase family protein -
  ABNX04_RS14995 (ABNX04_14995) degQ 3090378..3090518 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ABNX04_RS15000 (ABNX04_15000) - 3090984..3091325 (+) 342 WP_038459666.1 hypothetical protein -
  ABNX04_RS15005 (ABNX04_15005) - 3091332..3092555 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  ABNX04_RS15010 (ABNX04_15010) - 3092685..3094151 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ABNX04_RS15015 (ABNX04_15015) - 3094169..3094720 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  ABNX04_RS15020 (ABNX04_15020) - 3094817..3095215 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1016304 ABNX04_RS14995 WP_003152043.1 3090378..3090518(-) (degQ) [Bacillus velezensis strain JLU-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1016304 ABNX04_RS14995 WP_003152043.1 3090378..3090518(-) (degQ) [Bacillus velezensis strain JLU-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment