Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABVJ71_RS14740 Genome accession   NZ_CP159358
Coordinates   2873219..2873359 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. Bos-x628     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2868219..2878359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABVJ71_RS14715 - 2868459..2868866 (+) 408 WP_353854682.1 YueI family protein -
  ABVJ71_RS14720 - 2868927..2869478 (+) 552 WP_353854683.1 isochorismatase family cysteine hydrolase -
  ABVJ71_RS14725 - 2869557..2870966 (+) 1410 WP_353856704.1 nicotinate phosphoribosyltransferase -
  ABVJ71_RS14730 - 2871106..2872332 (+) 1227 WP_353856705.1 HDOD domain-containing protein -
  ABVJ71_RS14735 - 2872360..2872647 (-) 288 WP_353854684.1 inner spore coat protein -
  ABVJ71_RS14740 degQ 2873219..2873359 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ABVJ71_RS14745 - 2873511..2874416 (+) 906 WP_353854685.1 polyprenyl synthetase family protein -
  ABVJ71_RS14750 comX 2874422..2874589 (+) 168 WP_353854686.1 competence pheromone ComX -
  ABVJ71_RS14755 comP 2874647..2876959 (+) 2313 WP_353854687.1 ATP-binding protein Regulator
  ABVJ71_RS14760 comA 2877040..2877681 (+) 642 WP_353854688.1 response regulator transcription factor Regulator
  ABVJ71_RS14765 - 2877705..2878094 (+) 390 WP_353854689.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1013401 ABVJ71_RS14740 WP_003213123.1 2873219..2873359(+) (degQ) [Bacillus sp. Bos-x628]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1013401 ABVJ71_RS14740 WP_003213123.1 2873219..2873359(+) (degQ) [Bacillus sp. Bos-x628]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment