Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABUH86_RS14935 Genome accession   NZ_CP158669
Coordinates   3035899..3036039 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain XY40-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3030899..3041039
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABUH86_RS14910 (ABUH86_14910) - 3031239..3031622 (-) 384 WP_353406438.1 hotdog fold thioesterase -
  ABUH86_RS14915 (ABUH86_14915) comA 3031644..3032288 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ABUH86_RS14920 (ABUH86_14920) - 3032369..3034660 (-) 2292 Protein_2871 histidine kinase -
  ABUH86_RS14925 (ABUH86_14925) comX 3034672..3034836 (-) 165 WP_061581461.1 competence pheromone ComX -
  ABUH86_RS14930 (ABUH86_14930) - 3034836..3035714 (-) 879 WP_038460875.1 polyprenyl synthetase family protein -
  ABUH86_RS14935 (ABUH86_14935) degQ 3035899..3036039 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ABUH86_RS14940 (ABUH86_14940) - 3036504..3036845 (+) 342 WP_353406442.1 hypothetical protein -
  ABUH86_RS14945 (ABUH86_14945) - 3036852..3038064 (-) 1213 Protein_2876 EAL and HDOD domain-containing protein -
  ABUH86_RS14950 (ABUH86_14950) - 3038194..3039660 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  ABUH86_RS14955 (ABUH86_14955) - 3039678..3040229 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  ABUH86_RS14960 (ABUH86_14960) - 3040325..3040723 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -
  ABUH86_RS14965 (ABUH86_14965) - 3040789..3041037 (-) 249 WP_003152028.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1011944 ABUH86_RS14935 WP_003152043.1 3035899..3036039(-) (degQ) [Bacillus velezensis strain XY40-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1011944 ABUH86_RS14935 WP_003152043.1 3035899..3036039(-) (degQ) [Bacillus velezensis strain XY40-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment