Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ABUH86_RS02045 Genome accession   NZ_CP158669
Coordinates   408327..408446 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain XY40-1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 403327..413446
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABUH86_RS02030 (ABUH86_02030) - 404939..405622 (+) 684 WP_014416901.1 response regulator transcription factor -
  ABUH86_RS02035 (ABUH86_02035) - 405609..407042 (+) 1434 WP_353407176.1 HAMP domain-containing sensor histidine kinase -
  ABUH86_RS02040 (ABUH86_02040) rapC 407195..408343 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ABUH86_RS02045 (ABUH86_02045) phrC 408327..408446 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ABUH86_RS02050 (ABUH86_02050) - 408595..408690 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  ABUH86_RS02055 (ABUH86_02055) - 408785..410149 (-) 1365 WP_353407181.1 aspartate kinase -
  ABUH86_RS02060 (ABUH86_02060) ceuB 410563..411516 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  ABUH86_RS02065 (ABUH86_02065) - 411506..412453 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  ABUH86_RS02070 (ABUH86_02070) - 412447..413205 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1011894 ABUH86_RS02045 WP_003156334.1 408327..408446(+) (phrC) [Bacillus velezensis strain XY40-1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1011894 ABUH86_RS02045 WP_003156334.1 408327..408446(+) (phrC) [Bacillus velezensis strain XY40-1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment