Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ABOE65_RS14745 | Genome accession | NZ_CP158358 |
| Coordinates | 2977047..2977187 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain HY23 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2972047..2982187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABOE65_RS14720 (ABOE65_14705) | - | 2972393..2972776 (-) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
| ABOE65_RS14725 (ABOE65_14710) | comA | 2972798..2973442 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| ABOE65_RS14730 (ABOE65_14715) | comP | 2973523..2975823 (-) | 2301 | WP_012118313.1 | histidine kinase | Regulator |
| ABOE65_RS14735 (ABOE65_14720) | comX | 2975837..2976010 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| ABOE65_RS14740 (ABOE65_14725) | - | 2975979..2976839 (-) | 861 | WP_012118315.1 | polyprenyl synthetase family protein | - |
| ABOE65_RS14745 (ABOE65_14730) | degQ | 2977047..2977187 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ABOE65_RS14750 (ABOE65_14735) | - | 2977652..2977993 (+) | 342 | WP_012118316.1 | hypothetical protein | - |
| ABOE65_RS14755 (ABOE65_14740) | - | 2978000..2979223 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| ABOE65_RS14760 (ABOE65_14745) | - | 2979353..2980819 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| ABOE65_RS14765 (ABOE65_14750) | - | 2980837..2981388 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| ABOE65_RS14770 (ABOE65_14755) | - | 2981485..2981883 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1010882 ABOE65_RS14745 WP_003152043.1 2977047..2977187(-) (degQ) [Bacillus velezensis strain HY23]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1010882 ABOE65_RS14745 WP_003152043.1 2977047..2977187(-) (degQ) [Bacillus velezensis strain HY23]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |