Detailed information NTG1010657

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: H1W95_RS08830
• Genome accession: NZ_LR822030
• Coordinates: 1720446..1720763 (-)
• Length: 105 a.a.
• NCBI ID: WP_002952035.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus isolate STH_CIRM_1046
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1715446..1725763

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W95_RS08800 (STHERMO_1993)	-	1715805..1716467 (-)	663	WP_084826165.1	type II CAAX endopeptidase family protein	-
H1W95_RS08805 (STHERMO_1994)	-	1716564..1717007 (-)	444	WP_041829335.1	hypothetical protein	-
H1W95_RS10365 (STHERMO_1995)	-	1717081..1717419 (-)	339	WP_228024408.1	CPBP family intramembrane glutamic endopeptidase	-
H1W95_RS10370 (STHERMO_1996)	-	1717463..1717738 (-)	276	WP_084830830.1	CAAX protease	-
H1W95_RS08815 (STHERMO_1997)	-	1717750..1717947 (-)	198	WP_084826167.1	helix-turn-helix transcriptional regulator	-
H1W95_RS08820 (STHERMO_1998)	-	1718196..1719389 (-)	1194	WP_084826168.1	acetate kinase	-
H1W95_RS08825 (STHERMO_1999)	comGH	1719445..1720401 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
H1W95_RS08830 (STHERMO_2000)	comGG	1720446..1720763 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	Machinery gene
H1W95_RS08835 (STHERMO_2001)	comGF	1720741..1721178 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
H1W95_RS08840 (STHERMO_2002)	comGE	1721162..1721455 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
H1W95_RS08845 (STHERMO_2003)	comGD	1721427..1721855 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
H1W95_RS08850 (STHERMO_2004)	comGC	1721815..1722141 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
H1W95_RS08855 (STHERMO_2005)	comGB	1722138..1723238 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
H1W95_RS08860 (STHERMO_2006)	comGA/cglA/cilD	1723120..1724061 (-)	942	WP_180483385.1	competence type IV pilus ATPase ComGA	Machinery gene
H1W95_RS08865 (STHERMO_2007)	-	1724142..1724504 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11824.93 Da
• Isoelectric Point: 10.6334

>NTDB_id=1010657 H1W95_RS08830 WP_002952035.1 1720446..1720763(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_1046]
MLLKKQVRGGVLLYALFMAGIFTLLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=1010657 H1W95_RS08830 WP_002952035.1 1720446..1720763(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_1046]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae D39	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae R6	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae TIGR4	42.222	85.714	0.362