Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   H0514_RS01905 Genome accession   NZ_LR822020
Coordinates   360846..361085 (+) Length   79 a.a.
NCBI ID   WP_021152514.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_956     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 355846..366085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0514_RS01880 (STHERMO_0411) comE/blpR 356362..357099 (-) 738 WP_179972243.1 LytR/AlgR family response regulator transcription factor Regulator
  H0514_RS01885 (STHERMO_0412) - 357350..357526 (+) 177 WP_011681570.1 Blp family class II bacteriocin -
  H0514_RS01890 (STHERMO_0413) - 357545..357745 (+) 201 WP_011681569.1 hypothetical protein -
  H0514_RS01895 (STHERMO_0414) - 358101..358331 (+) 231 WP_011226494.1 bacteriocin class II family protein -
  H0514_RS11110 (STHERMO_0420) - 359354..359755 (+) 402 WP_011226490.1 hypothetical protein -
  H0514_RS01900 (STHERMO_0421) - 360006..360260 (+) 255 WP_179972242.1 Blp family class II bacteriocin -
  H0514_RS01905 (STHERMO_0424) cipB 360846..361085 (+) 240 WP_021152514.1 Blp family class II bacteriocin Regulator
  H0514_RS01910 (STHERMO_0425) - 361097..361489 (+) 393 WP_084829084.1 hypothetical protein -
  H0514_RS01915 (STHERMO_0426) - 361518..361697 (+) 180 WP_011681564.1 hypothetical protein -
  H0514_RS01920 (STHERMO_0427) - 361884..362810 (+) 927 WP_022096485.1 thioredoxin family protein -
  H0514_RS01925 (STHERMO_0428) - 362975..363271 (+) 297 WP_004197070.1 bacteriocin immunity protein -
  H0514_RS01930 - 363593..363856 (+) 264 WP_002945924.1 hypothetical protein -
  H0514_RS01935 (STHERMO_0431) - 363981..364361 (+) 381 WP_002951783.1 hypothetical protein -

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7695.63 Da        Isoelectric Point: 3.8735

>NTDB_id=1009941 H0514_RS01905 WP_021152514.1 360846..361085(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_956]
MATQTIENFNTLDLETLASVEGGRVNWERWGVCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=1009941 H0514_RS01905 WP_021152514.1 360846..361085(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_956]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAGTGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405

Multiple sequence alignment