Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ABL091_RS11720 Genome accession   NZ_CP157944
Coordinates   2443038..2443475 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain B6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2438038..2448475
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABL091_RS11670 (ABL091_11665) sinI 2438421..2438594 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ABL091_RS11675 (ABL091_11670) sinR 2438628..2438963 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABL091_RS11680 (ABL091_11675) - 2439011..2439796 (-) 786 WP_007408329.1 TasA family protein -
  ABL091_RS11685 (ABL091_11680) - 2439861..2440445 (-) 585 WP_022552967.1 signal peptidase I -
  ABL091_RS11690 (ABL091_11685) tapA 2440417..2441088 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ABL091_RS11695 (ABL091_11690) - 2441347..2441676 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ABL091_RS11700 (ABL091_11695) - 2441717..2441896 (-) 180 WP_022552966.1 YqzE family protein -
  ABL091_RS11705 (ABL091_11700) comGG 2441953..2442330 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABL091_RS11710 (ABL091_11705) comGF 2442331..2442726 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ABL091_RS11715 (ABL091_11710) comGE 2442740..2443054 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABL091_RS11720 (ABL091_11715) comGD 2443038..2443475 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABL091_RS11725 (ABL091_11720) comGC 2443465..2443773 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ABL091_RS11730 (ABL091_11725) comGB 2443778..2444815 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABL091_RS11735 (ABL091_11730) comGA 2444802..2445872 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  ABL091_RS11740 (ABL091_11735) - 2446065..2447015 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  ABL091_RS11745 (ABL091_11740) - 2447161..2448462 (+) 1302 WP_022552961.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=1009271 ABL091_RS11720 WP_007612572.1 2443038..2443475(-) (comGD) [Bacillus velezensis strain B6]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1009271 ABL091_RS11720 WP_007612572.1 2443038..2443475(-) (comGD) [Bacillus velezensis strain B6]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment