Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABL091_RS11670 | Genome accession | NZ_CP157944 |
| Coordinates | 2438421..2438594 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain B6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2433421..2443594
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABL091_RS11655 (ABL091_11650) | gcvT | 2434234..2435334 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABL091_RS11660 (ABL091_11655) | - | 2435758..2437428 (+) | 1671 | WP_038461530.1 | SNF2-related protein | - |
| ABL091_RS11665 (ABL091_11660) | - | 2437450..2438244 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| ABL091_RS11670 (ABL091_11665) | sinI | 2438421..2438594 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| ABL091_RS11675 (ABL091_11670) | sinR | 2438628..2438963 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABL091_RS11680 (ABL091_11675) | - | 2439011..2439796 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| ABL091_RS11685 (ABL091_11680) | - | 2439861..2440445 (-) | 585 | WP_022552967.1 | signal peptidase I | - |
| ABL091_RS11690 (ABL091_11685) | tapA | 2440417..2441088 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABL091_RS11695 (ABL091_11690) | - | 2441347..2441676 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ABL091_RS11700 (ABL091_11695) | - | 2441717..2441896 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| ABL091_RS11705 (ABL091_11700) | comGG | 2441953..2442330 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABL091_RS11710 (ABL091_11705) | comGF | 2442331..2442726 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ABL091_RS11715 (ABL091_11710) | comGE | 2442740..2443054 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ABL091_RS11720 (ABL091_11715) | comGD | 2443038..2443475 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=1009267 ABL091_RS11670 WP_014418369.1 2438421..2438594(+) (sinI) [Bacillus velezensis strain B6]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1009267 ABL091_RS11670 WP_014418369.1 2438421..2438594(+) (sinI) [Bacillus velezensis strain B6]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |