Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABK447_RS07700 | Genome accession | NZ_CP157943 |
| Coordinates | 1474880..1475053 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. hwrm1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1469880..1480053
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABK447_RS07650 (ABK447_07640) | comGD | 1470000..1470437 (+) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ABK447_RS07655 (ABK447_07645) | comGE | 1470421..1470735 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ABK447_RS07660 (ABK447_07650) | comGF | 1470644..1471144 (+) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| ABK447_RS07665 (ABK447_07655) | comGG | 1471145..1471522 (+) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABK447_RS07670 (ABK447_07660) | - | 1471579..1471758 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| ABK447_RS07675 (ABK447_07665) | - | 1471798..1472127 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ABK447_RS07680 (ABK447_07670) | tapA | 1472386..1473057 (+) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABK447_RS07685 (ABK447_07675) | sipW | 1473029..1473613 (+) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ABK447_RS07690 (ABK447_07680) | tasA | 1473678..1474463 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ABK447_RS07695 (ABK447_07685) | sinR | 1474511..1474846 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABK447_RS07700 (ABK447_07690) | sinI | 1474880..1475053 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ABK447_RS07705 (ABK447_07695) | - | 1475230..1476024 (-) | 795 | WP_076424968.1 | YqhG family protein | - |
| ABK447_RS07710 (ABK447_07700) | - | 1476046..1477716 (-) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| ABK447_RS07715 (ABK447_07705) | gcvT | 1478140..1479240 (+) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1009186 ABK447_RS07700 WP_003153105.1 1474880..1475053(-) (sinI) [Bacillus sp. hwrm1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1009186 ABK447_RS07700 WP_003153105.1 1474880..1475053(-) (sinI) [Bacillus sp. hwrm1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |