Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   ABK447_RS07645 Genome accession   NZ_CP157943
Coordinates   1469744..1470010 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus sp. hwrm1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1464744..1475010
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABK447_RS07625 (ABK447_07615) - 1465012..1466313 (-) 1302 WP_021494315.1 hemolysin family protein -
  ABK447_RS07630 (ABK447_07620) - 1466459..1467409 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  ABK447_RS07635 (ABK447_07625) comGA 1467603..1468673 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ABK447_RS07640 (ABK447_07630) comGB 1468660..1469697 (+) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABK447_RS07645 (ABK447_07635) comGC 1469744..1470010 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ABK447_RS07650 (ABK447_07640) comGD 1470000..1470437 (+) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABK447_RS07655 (ABK447_07645) comGE 1470421..1470735 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ABK447_RS07660 (ABK447_07650) comGF 1470644..1471144 (+) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ABK447_RS07665 (ABK447_07655) comGG 1471145..1471522 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABK447_RS07670 (ABK447_07660) - 1471579..1471758 (+) 180 WP_003153093.1 YqzE family protein -
  ABK447_RS07675 (ABK447_07665) - 1471798..1472127 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ABK447_RS07680 (ABK447_07670) tapA 1472386..1473057 (+) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  ABK447_RS07685 (ABK447_07675) sipW 1473029..1473613 (+) 585 WP_015240205.1 signal peptidase I SipW -
  ABK447_RS07690 (ABK447_07680) tasA 1473678..1474463 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ABK447_RS07695 (ABK447_07685) sinR 1474511..1474846 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=1009182 ABK447_RS07645 WP_042635730.1 1469744..1470010(+) (comGC) [Bacillus sp. hwrm1]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=1009182 ABK447_RS07645 WP_042635730.1 1469744..1470010(+) (comGC) [Bacillus sp. hwrm1]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment