Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABI116_RS17220 Genome accession   NZ_CP157214
Coordinates   3256654..3256794 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS21     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251654..3261794
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABI116_RS17195 (ABI116_17195) yuxO 3251967..3252347 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ABI116_RS17200 (ABI116_17200) comA 3252366..3253010 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABI116_RS17205 (ABI116_17205) comP 3253091..3255400 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  ABI116_RS17210 (ABI116_17210) comX 3255415..3255582 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ABI116_RS17215 (ABI116_17215) comQ 3255570..3256469 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ABI116_RS17220 (ABI116_17220) degQ 3256654..3256794 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABI116_RS17225 (ABI116_17225) - 3257016..3257141 (+) 126 WP_003228793.1 hypothetical protein -
  ABI116_RS17230 (ABI116_17230) - 3257255..3257623 (+) 369 WP_003243784.1 hypothetical protein -
  ABI116_RS17235 (ABI116_17235) pdeH 3257599..3258828 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ABI116_RS17240 (ABI116_17240) pncB 3258965..3260437 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABI116_RS17245 (ABI116_17245) pncA 3260453..3261004 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  ABI116_RS17250 (ABI116_17250) yueI 3261101..3261499 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1004780 ABI116_RS17220 WP_003220708.1 3256654..3256794(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS21]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1004780 ABI116_RS17220 WP_003220708.1 3256654..3256794(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS21]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment