Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABI116_RS13380 Genome accession   NZ_CP157214
Coordinates   2555698..2556072 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS21     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2550698..2561072
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABI116_RS13340 (ABI116_13340) yqhG 2551030..2551824 (+) 795 WP_003230200.1 YqhG family protein -
  ABI116_RS13345 (ABI116_13345) sinI 2552007..2552180 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABI116_RS13350 (ABI116_13350) sinR 2552214..2552549 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABI116_RS13355 (ABI116_13355) tasA 2552642..2553427 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ABI116_RS13360 (ABI116_13360) sipW 2553491..2554063 (-) 573 WP_003246088.1 signal peptidase I -
  ABI116_RS13365 (ABI116_13365) tapA 2554047..2554808 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ABI116_RS13370 (ABI116_13370) yqzG 2555080..2555406 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABI116_RS13375 (ABI116_13375) spoIIT 2555448..2555627 (-) 180 WP_003230176.1 YqzE family protein -
  ABI116_RS13380 (ABI116_13380) comGG 2555698..2556072 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABI116_RS13385 (ABI116_13385) comGF 2556073..2556456 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABI116_RS13390 (ABI116_13390) comGE 2556482..2556829 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ABI116_RS13395 (ABI116_13395) comGD 2556813..2557244 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ABI116_RS13400 (ABI116_13400) comGC 2557234..2557530 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABI116_RS13405 (ABI116_13405) comGB 2557544..2558581 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ABI116_RS13410 (ABI116_13410) comGA 2558568..2559638 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ABI116_RS13415 (ABI116_13415) corA 2560050..2561003 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=1004756 ABI116_RS13380 WP_003230170.1 2555698..2556072(-) (comGG) [Bacillus subtilis subsp. subtilis isolate FELIX_MS21]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1004756 ABI116_RS13380 WP_003230170.1 2555698..2556072(-) (comGG) [Bacillus subtilis subsp. subtilis isolate FELIX_MS21]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment