Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABI116_RS13345 | Genome accession | NZ_CP157214 |
| Coordinates | 2552007..2552180 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis isolate FELIX_MS21 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547007..2557180
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABI116_RS13330 (ABI116_13330) | gcvT | 2547806..2548894 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABI116_RS13335 (ABI116_13335) | yqhH | 2549336..2551009 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| ABI116_RS13340 (ABI116_13340) | yqhG | 2551030..2551824 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| ABI116_RS13345 (ABI116_13345) | sinI | 2552007..2552180 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| ABI116_RS13350 (ABI116_13350) | sinR | 2552214..2552549 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ABI116_RS13355 (ABI116_13355) | tasA | 2552642..2553427 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| ABI116_RS13360 (ABI116_13360) | sipW | 2553491..2554063 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| ABI116_RS13365 (ABI116_13365) | tapA | 2554047..2554808 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABI116_RS13370 (ABI116_13370) | yqzG | 2555080..2555406 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| ABI116_RS13375 (ABI116_13375) | spoIIT | 2555448..2555627 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| ABI116_RS13380 (ABI116_13380) | comGG | 2555698..2556072 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| ABI116_RS13385 (ABI116_13385) | comGF | 2556073..2556456 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| ABI116_RS13390 (ABI116_13390) | comGE | 2556482..2556829 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1004754 ABI116_RS13345 WP_003230187.1 2552007..2552180(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS21]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1004754 ABI116_RS13345 WP_003230187.1 2552007..2552180(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS21]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |