Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABH595_RS17255 Genome accession   NZ_CP157084
Coordinates   3265751..3265891 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3260751..3270891
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABH595_RS17230 (ABH595_17230) yuxO 3261064..3261444 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ABH595_RS17235 (ABH595_17235) comA 3261463..3262107 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABH595_RS17240 (ABH595_17240) comP 3262188..3264497 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  ABH595_RS17245 (ABH595_17245) comX 3264512..3264679 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ABH595_RS17250 (ABH595_17250) comQ 3264667..3265566 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ABH595_RS17255 (ABH595_17255) degQ 3265751..3265891 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABH595_RS17260 (ABH595_17260) - 3266113..3266238 (+) 126 WP_003228793.1 hypothetical protein -
  ABH595_RS17265 (ABH595_17265) - 3266352..3266720 (+) 369 WP_003243784.1 hypothetical protein -
  ABH595_RS17270 (ABH595_17270) pdeH 3266696..3267925 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ABH595_RS17275 (ABH595_17275) pncB 3268062..3269534 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABH595_RS17280 (ABH595_17280) pncA 3269550..3270101 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  ABH595_RS17285 (ABH595_17285) yueI 3270198..3270596 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1004112 ABH595_RS17255 WP_003220708.1 3265751..3265891(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1004112 ABH595_RS17255 WP_003220708.1 3265751..3265891(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment