Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   ABH595_RS06280 Genome accession   NZ_CP157084
Coordinates   1216254..1216445 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS9     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1211254..1221445
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABH595_RS06250 (ABH595_06250) argF 1212118..1213077 (+) 960 WP_003232980.1 ornithine carbamoyltransferase -
  ABH595_RS06255 (ABH595_06255) yjzC 1213163..1213342 (+) 180 WP_003245356.1 YjzC family protein -
  ABH595_RS06260 (ABH595_06260) yjzD 1213388..1213573 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  ABH595_RS06265 (ABH595_06265) - 1213822..1214556 (+) 735 WP_003245223.1 hypothetical protein -
  ABH595_RS06270 (ABH595_06270) - 1214638..1215195 (+) 558 WP_003232974.1 hypothetical protein -
  ABH595_RS06275 (ABH595_06275) med 1215286..1216239 (+) 954 WP_003245494.1 transcriptional regulator Med Regulator
  ABH595_RS06280 (ABH595_06280) comZ 1216254..1216445 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  ABH595_RS06285 (ABH595_06285) yjzB 1216475..1216714 (-) 240 WP_003232972.1 spore coat protein YjzB -
  ABH595_RS06290 (ABH595_06290) fabH 1216879..1217817 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  ABH595_RS06295 (ABH595_06295) fabF 1217840..1219081 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  ABH595_RS06300 (ABH595_06300) yjaZ 1219157..1219942 (+) 786 WP_003232967.1 DUF2268 domain-containing protein -
  ABH595_RS06305 (ABH595_06305) appD 1220134..1221120 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=1004068 ABH595_RS06280 WP_003224559.1 1216254..1216445(+) (comZ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=1004068 ABH595_RS06280 WP_003224559.1 1216254..1216445(+) (comZ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS9]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment