Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   E0F40_RS02545 Genome accession   NZ_LR216065
Coordinates   460263..460412 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain GPSC18 substr. ST13 isolate 55896440-41bd-11e5-998e-3c4a9275d6c6     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 455263..465412
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E0F40_RS02505 (SAMEA3714487_00457) blpU 457127..457357 (+) 231 WP_001093268.1 bacteriocin-like peptide BlpU -
  E0F40_RS02510 - 457360..457479 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  E0F40_RS11705 (SAMEA3714487_00458) - 457776..457940 (+) 165 WP_000727118.1 hypothetical protein -
  E0F40_RS02520 (SAMEA3714487_00459) - 457937..458341 (+) 405 WP_000846944.1 hypothetical protein -
  E0F40_RS02525 - 458539..459344 (+) 806 Protein_471 IS5 family transposase -
  E0F40_RS02530 (SAMEA3714487_00462) blpM 459546..459800 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  E0F40_RS02535 (SAMEA3714487_00463) blpN 459816..460019 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  E0F40_RS02545 (SAMEA3714487_00464) cipB 460263..460412 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator
  E0F40_RS02550 - 460516..460635 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  E0F40_RS02560 (SAMEA3714487_00465) - 461421..461804 (+) 384 WP_000877378.1 hypothetical protein -
  E0F40_RS02565 (SAMEA3714487_00466) - 461856..462545 (+) 690 WP_000760541.1 CPBP family intramembrane glutamic endopeptidase -
  E0F40_RS02570 (SAMEA3714487_00467) blpZ 462587..462820 (+) 234 WP_000276498.1 immunity protein BlpZ -
  E0F40_RS02580 (SAMEA3714487_00468) - 462971..463582 (+) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  E0F40_RS02585 (SAMEA3714487_00469) ccrZ 463743..464537 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  E0F40_RS02590 (SAMEA3714487_00470) trmB 464534..465169 (+) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=1004067 E0F40_RS02545 WP_001813641.1 460263..460412(+) (cipB) [Streptococcus pneumoniae strain GPSC18 substr. ST13 isolate 55896440-41bd-11e5-998e-3c4a9275d6c6]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1004067 E0F40_RS02545 WP_001813641.1 460263..460412(+) (cipB) [Streptococcus pneumoniae strain GPSC18 substr. ST13 isolate 55896440-41bd-11e5-998e-3c4a9275d6c6]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49


Multiple sequence alignment