Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE   Type   Machinery gene
Locus tag   ABEF84_RS01920 Genome accession   NZ_CP156795
Coordinates   402804..403256 (+) Length   150 a.a.
NCBI ID   WP_347454473.1    Uniprot ID   -
Organism   Acinetobacter thermotolerans strain ANC 7912     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 368363..417820 402804..403256 within 0


Gene organization within MGE regions


Location: 368363..417820
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEF84_RS01760 (ABEF84_01760) - 368363..370186 (+) 1824 WP_347473751.1 hypothetical protein -
  ABEF84_RS01765 (ABEF84_01765) - 370256..371104 (+) 849 WP_404798973.1 glycosyltransferase family 2 protein -
  ABEF84_RS01770 (ABEF84_01770) - 371108..372823 (+) 1716 WP_347473753.1 ABC transporter ATP-binding protein -
  ABEF84_RS01775 (ABEF84_01775) - 372921..373955 (+) 1035 WP_347473754.1 glycosyltransferase -
  ABEF84_RS01780 (ABEF84_01780) - 373977..374360 (+) 384 WP_347473755.1 transposase -
  ABEF84_RS01785 (ABEF84_01785) - 374382..374765 (+) 384 WP_347473755.1 transposase -
  ABEF84_RS01790 (ABEF84_01790) - 374929..375312 (+) 384 WP_001055585.1 transposase -
  ABEF84_RS01795 (ABEF84_01795) tnpB 375309..375644 (+) 336 WP_000618091.1 IS66 family insertion sequence element accessory protein TnpB -
  ABEF84_RS01800 (ABEF84_01800) tnpC 375719..377323 (+) 1605 WP_347453595.1 IS66 family transposase -
  ABEF84_RS01805 (ABEF84_01805) - 377346..377426 (+) 81 Protein_343 IS66 family insertion sequence element accessory protein TnpB -
  ABEF84_RS01810 (ABEF84_01810) tnpB 377423..377758 (+) 336 WP_000618091.1 IS66 family insertion sequence element accessory protein TnpB -
  ABEF84_RS01815 (ABEF84_01815) tnpC 377833..379437 (+) 1605 WP_347473756.1 IS66 family transposase -
  ABEF84_RS01820 (ABEF84_01820) - 379757..381181 (+) 1425 WP_347473757.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  ABEF84_RS01825 (ABEF84_01825) gmd 381391..382425 (+) 1035 WP_347473758.1 GDP-mannose 4,6-dehydratase -
  ABEF84_RS01830 (ABEF84_01830) - 382445..383341 (+) 897 WP_347473759.1 GDP-mannose 4,6-dehydratase -
  ABEF84_RS01835 (ABEF84_01835) - 383398..384825 (+) 1428 WP_347473760.1 glycosyltransferase family 1 protein -
  ABEF84_RS01840 (ABEF84_01840) - 384908..385993 (+) 1086 WP_347473761.1 glycosyltransferase family 1 protein -
  ABEF84_RS01845 (ABEF84_01845) - 385994..387022 (-) 1029 WP_347473762.1 glycosyltransferase family 4 protein -
  ABEF84_RS01850 (ABEF84_01850) - 387019..388197 (-) 1179 WP_347454484.1 glycosyltransferase family 4 protein -
  ABEF84_RS01855 (ABEF84_01855) - 388285..389919 (+) 1635 WP_347454483.1 Wzy polymerase domain-containing protein -
  ABEF84_RS01860 (ABEF84_01860) bfr 389987..390451 (-) 465 WP_347454482.1 bacterioferritin -
  ABEF84_RS01865 (ABEF84_01865) - 390691..390885 (-) 195 WP_347453509.1 bacterioferritin-associated ferredoxin -
  ABEF84_RS01870 (ABEF84_01870) - 391074..391457 (-) 384 WP_347473288.1 RidA family protein -
  ABEF84_RS01875 (ABEF84_01875) - 391533..393635 (-) 2103 WP_347473287.1 HD domain-containing protein -
  ABEF84_RS01880 (ABEF84_01880) rpoZ 393847..394128 (-) 282 WP_004650579.1 DNA-directed RNA polymerase subunit omega -
  ABEF84_RS01885 (ABEF84_01885) gmk 394203..394826 (-) 624 WP_347453512.1 guanylate kinase -
  ABEF84_RS01890 (ABEF84_01890) ispH 394961..395911 (+) 951 WP_347454479.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  ABEF84_RS01895 (ABEF84_01895) - 396075..396560 (+) 486 WP_347473286.1 GspH/FimT family pseudopilin -
  ABEF84_RS01900 (ABEF84_01900) pilV 396563..397114 (+) 552 WP_347473285.1 type IV pilus modification protein PilV -
  ABEF84_RS01905 (ABEF84_01905) - 397114..398082 (+) 969 WP_347454476.1 PilW family protein -
  ABEF84_RS01910 (ABEF84_01910) - 398083..398856 (+) 774 WP_347454475.1 pilus assembly protein -
  ABEF84_RS01915 (ABEF84_01915) - 398876..402793 (+) 3918 WP_347473511.1 PilC/PilY family type IV pilus protein -
  ABEF84_RS01920 (ABEF84_01920) comE 402804..403256 (+) 453 WP_347454473.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  ABEF84_RS01925 (ABEF84_01925) - 403250..403693 (+) 444 WP_347473284.1 type IV pilin protein -
  ABEF84_RS01930 (ABEF84_01930) rpsP 403819..404076 (+) 258 WP_034587736.1 30S ribosomal protein S16 -
  ABEF84_RS01935 (ABEF84_01935) rimM 404106..404654 (+) 549 WP_347453520.1 ribosome maturation factor RimM -
  ABEF84_RS01940 (ABEF84_01940) trmD 404696..405445 (+) 750 WP_347454471.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ABEF84_RS01945 (ABEF84_01945) rplS 405622..405993 (+) 372 WP_004787066.1 50S ribosomal protein L19 -
  ABEF84_RS01950 (ABEF84_01950) - 406055..407038 (-) 984 WP_404798936.1 lipase family alpha/beta hydrolase -
  ABEF84_RS01955 (ABEF84_01955) - 407574..408605 (-) 1032 WP_347454469.1 lipase secretion chaperone -
  ABEF84_RS01960 (ABEF84_01960) truB 408761..409666 (+) 906 WP_347454468.1 tRNA pseudouridine(55) synthase TruB -
  ABEF84_RS01965 (ABEF84_01965) - 409689..410456 (+) 768 WP_347454467.1 TSUP family transporter -
  ABEF84_RS01970 (ABEF84_01970) - 410584..411051 (+) 468 WP_347454466.1 hemerythrin domain-containing protein -
  ABEF84_RS01975 (ABEF84_01975) - 411106..411519 (-) 414 WP_347454465.1 hypothetical protein -
  ABEF84_RS01980 (ABEF84_01980) - 411591..412469 (-) 879 WP_347453527.1 EamA family transporter -
  ABEF84_RS01985 (ABEF84_01985) - 412653..413529 (-) 877 Protein_379 IS982-like element ISAba825 family transposase -
  ABEF84_RS01990 (ABEF84_01990) - 413773..414924 (+) 1152 WP_347454464.1 hypothetical protein -
  ABEF84_RS01995 (ABEF84_01995) - 415047..415220 (+) 174 WP_347454463.1 hypothetical protein -
  ABEF84_RS02000 (ABEF84_02000) - 415266..415859 (+) 594 WP_347454462.1 hypothetical protein -
  ABEF84_RS02005 (ABEF84_02005) - 415856..416914 (-) 1059 WP_034586922.1 RNA-guided endonuclease TnpB family protein -
  ABEF84_RS02010 (ABEF84_02010) tnpA 416935..417348 (+) 414 Protein_384 IS200/IS605 family transposase -
  ABEF84_RS02015 (ABEF84_02015) - 417503..417820 (+) 318 WP_347454461.1 hypothetical protein -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 17034.39 Da        Isoelectric Point: 5.2667

>NTDB_id=1002880 ABEF84_RS01920 WP_347454473.1 402804..403256(+) (comE) [Acinetobacter thermotolerans strain ANC 7912]
MQDSKGFTLIELMIVVVILAIIAAIAIPSYKETIRKNNEAKAQQEILKVAEQLERYRARNFNYRNFTATNVILPDGYSLN
IYDLDSTNKGLGDGVQGRGWFIKVEPPTDPKNYYFLMSSTGLKCKSRLESDVDFKCEPWDDSAQTGSQPW

Nucleotide


Download         Length: 453 bp        

>NTDB_id=1002880 ABEF84_RS01920 WP_347454473.1 402804..403256(+) (comE) [Acinetobacter thermotolerans strain ANC 7912]
ATGCAGGATAGCAAAGGTTTCACCTTGATTGAGCTAATGATTGTGGTGGTGATCCTTGCGATCATTGCTGCAATCGCTAT
ACCAAGCTATAAGGAAACCATCAGGAAAAATAATGAGGCGAAAGCTCAGCAGGAAATATTAAAAGTTGCTGAGCAATTAG
AACGGTATCGTGCCAGAAATTTTAATTATCGAAATTTCACTGCCACGAATGTGATACTTCCTGATGGATATAGTTTAAAT
ATCTATGATTTAGATAGTACCAATAAAGGGTTAGGTGATGGAGTTCAAGGACGAGGATGGTTTATTAAAGTAGAGCCGCC
AACCGATCCTAAAAACTATTATTTTCTTATGAGTAGCACAGGTTTAAAGTGTAAATCACGTTTAGAGAGTGATGTGGATT
TTAAATGTGAGCCTTGGGATGATAGTGCACAAACAGGAAGTCAGCCATGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Acinetobacter baylyi ADP1

42.69

100

0.487

  pilY2 Acinetobacter baumannii D1279779

40.26

100

0.413


Multiple sequence alignment