Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE   Type   Machinery gene
Locus tag   ABEF86_RS13585 Genome accession   NZ_CP156780
Coordinates   2752384..2752836 (-) Length   150 a.a.
NCBI ID   WP_347454473.1    Uniprot ID   -
Organism   Acinetobacter thermotolerans strain ANC 7933     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2738726..2782688 2752384..2752836 within 0


Gene organization within MGE regions


Location: 2738726..2782688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEF86_RS13500 (ABEF86_13500) - 2738726..2739784 (+) 1059 WP_034586922.1 RNA-guided endonuclease TnpB family protein -
  ABEF86_RS13505 (ABEF86_13505) - 2739781..2740374 (-) 594 WP_347454462.1 hypothetical protein -
  ABEF86_RS13510 (ABEF86_13510) - 2740420..2740593 (-) 174 WP_347454463.1 hypothetical protein -
  ABEF86_RS13515 (ABEF86_13515) - 2740716..2741867 (-) 1152 WP_347454464.1 hypothetical protein -
  ABEF86_RS13520 (ABEF86_13520) - 2742111..2742987 (+) 877 Protein_2615 IS982-like element ISAba825 family transposase -
  ABEF86_RS13525 (ABEF86_13525) - 2743171..2744049 (+) 879 WP_347453527.1 EamA family transporter -
  ABEF86_RS13530 (ABEF86_13530) - 2744121..2744534 (+) 414 WP_347454465.1 hypothetical protein -
  ABEF86_RS13535 (ABEF86_13535) - 2744589..2745056 (-) 468 WP_347454466.1 hemerythrin domain-containing protein -
  ABEF86_RS13540 (ABEF86_13540) - 2745184..2745951 (-) 768 WP_347454467.1 TSUP family transporter -
  ABEF86_RS13545 (ABEF86_13545) truB 2745974..2746879 (-) 906 WP_347454468.1 tRNA pseudouridine(55) synthase TruB -
  ABEF86_RS13550 (ABEF86_13550) - 2747035..2748066 (+) 1032 WP_347454469.1 lipase secretion chaperone -
  ABEF86_RS13555 (ABEF86_13555) - 2748602..2749585 (+) 984 WP_404798930.1 lipase family alpha/beta hydrolase -
  ABEF86_RS13560 (ABEF86_13560) rplS 2749647..2750018 (-) 372 WP_004787066.1 50S ribosomal protein L19 -
  ABEF86_RS13565 (ABEF86_13565) trmD 2750195..2750944 (-) 750 WP_347454471.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ABEF86_RS13570 (ABEF86_13570) rimM 2750986..2751534 (-) 549 WP_347453520.1 ribosome maturation factor RimM -
  ABEF86_RS13575 (ABEF86_13575) rpsP 2751564..2751821 (-) 258 WP_034587736.1 30S ribosomal protein S16 -
  ABEF86_RS13580 (ABEF86_13580) - 2751947..2752390 (-) 444 WP_347473284.1 type IV pilin protein -
  ABEF86_RS13585 (ABEF86_13585) comE 2752384..2752836 (-) 453 WP_347454473.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  ABEF86_RS13590 (ABEF86_13590) - 2752847..2756764 (-) 3918 WP_347473511.1 PilC/PilY family type IV pilus protein -
  ABEF86_RS13595 (ABEF86_13595) - 2756784..2757557 (-) 774 WP_347454475.1 pilus assembly protein -
  ABEF86_RS13600 (ABEF86_13600) - 2757558..2758526 (-) 969 WP_347454476.1 PilW family protein -
  ABEF86_RS13605 (ABEF86_13605) pilV 2758526..2759077 (-) 552 WP_347473285.1 type IV pilus modification protein PilV -
  ABEF86_RS13610 (ABEF86_13610) - 2759080..2759565 (-) 486 WP_347473286.1 GspH/FimT family pseudopilin -
  ABEF86_RS13615 (ABEF86_13615) ispH 2759729..2760679 (-) 951 WP_347454479.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  ABEF86_RS13620 (ABEF86_13620) gmk 2760814..2761437 (+) 624 WP_347453512.1 guanylate kinase -
  ABEF86_RS13625 (ABEF86_13625) rpoZ 2761512..2761793 (+) 282 WP_004650579.1 DNA-directed RNA polymerase subunit omega -
  ABEF86_RS13630 (ABEF86_13630) - 2762005..2764107 (+) 2103 WP_347473287.1 HD domain-containing protein -
  ABEF86_RS13635 (ABEF86_13635) - 2764183..2764566 (+) 384 WP_347473288.1 RidA family protein -
  ABEF86_RS13640 (ABEF86_13640) - 2764755..2764949 (+) 195 WP_347453509.1 bacterioferritin-associated ferredoxin -
  ABEF86_RS13645 (ABEF86_13645) bfr 2765189..2765653 (+) 465 WP_347454482.1 bacterioferritin -
  ABEF86_RS13650 (ABEF86_13650) - 2765721..2767355 (-) 1635 WP_347454483.1 Wzy polymerase domain-containing protein -
  ABEF86_RS13655 (ABEF86_13655) - 2767443..2768621 (+) 1179 WP_347454484.1 glycosyltransferase family 4 protein -
  ABEF86_RS13660 (ABEF86_13660) - 2768618..2769646 (+) 1029 WP_347454485.1 glycosyltransferase family 4 protein -
  ABEF86_RS13665 (ABEF86_13665) - 2769647..2770732 (-) 1086 WP_347454486.1 glycosyltransferase family 1 protein -
  ABEF86_RS13670 (ABEF86_13670) - 2770870..2771517 (-) 648 WP_347473289.1 glycosyltransferase family 1 protein -
  ABEF86_RS13675 (ABEF86_13675) - 2771636..2772865 (+) 1230 WP_168419539.1 transposase -
  ABEF86_RS13680 (ABEF86_13680) - 2772846..2773628 (-) 783 WP_347473290.1 glycosyltransferase -
  ABEF86_RS13685 (ABEF86_13685) - 2773693..2774580 (-) 888 WP_347454488.1 NAD-dependent epimerase/dehydratase family protein -
  ABEF86_RS13690 (ABEF86_13690) gmd 2774600..2775634 (-) 1035 WP_347454489.1 GDP-mannose 4,6-dehydratase -
  ABEF86_RS13695 (ABEF86_13695) - 2775844..2777268 (-) 1425 WP_347454490.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  ABEF86_RS13700 (ABEF86_13700) - 2777406..2778107 (-) 702 WP_347454491.1 class I SAM-dependent methyltransferase -
  ABEF86_RS13705 (ABEF86_13705) - 2778120..2779838 (-) 1719 WP_347473291.1 ABC transporter ATP-binding protein -
  ABEF86_RS13710 (ABEF86_13710) - 2779842..2780690 (-) 849 WP_347454493.1 glycosyltransferase family 2 protein -
  ABEF86_RS13715 (ABEF86_13715) - 2780862..2782688 (-) 1827 WP_347454494.1 hypothetical protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17034.39 Da        Isoelectric Point: 5.2667

>NTDB_id=1002726 ABEF86_RS13585 WP_347454473.1 2752384..2752836(-) (comE) [Acinetobacter thermotolerans strain ANC 7933]
MQDSKGFTLIELMIVVVILAIIAAIAIPSYKETIRKNNEAKAQQEILKVAEQLERYRARNFNYRNFTATNVILPDGYSLN
IYDLDSTNKGLGDGVQGRGWFIKVEPPTDPKNYYFLMSSTGLKCKSRLESDVDFKCEPWDDSAQTGSQPW

Nucleotide


Download         Length: 453 bp        

>NTDB_id=1002726 ABEF86_RS13585 WP_347454473.1 2752384..2752836(-) (comE) [Acinetobacter thermotolerans strain ANC 7933]
ATGCAGGATAGCAAAGGTTTCACCTTGATTGAGCTAATGATTGTGGTGGTGATCCTTGCGATCATTGCTGCAATCGCTAT
ACCAAGCTATAAGGAAACCATCAGGAAAAATAATGAGGCGAAAGCTCAGCAGGAAATATTAAAAGTTGCTGAGCAATTAG
AACGGTATCGTGCCAGAAATTTTAATTATCGAAATTTCACTGCCACGAATGTGATACTTCCTGATGGATATAGTTTAAAT
ATCTATGATTTAGATAGTACCAATAAAGGGTTAGGTGATGGAGTTCAAGGACGAGGATGGTTTATTAAAGTAGAGCCGCC
AACCGATCCTAAAAACTATTATTTTCTTATGAGTAGCACAGGTTTAAAGTGTAAATCACGTTTAGAGAGTGATGTGGATT
TTAAATGTGAGCCTTGGGATGATAGTGCACAAACAGGAAGTCAGCCATGGTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-73)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Acinetobacter baylyi ADP1

42.69

100

0.487
  pilY2 Acinetobacter baumannii D1279779

40.26

100

0.413

Multiple sequence alignment