Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE   Type   Machinery gene
Locus tag   ABEF83_RS13500 Genome accession   NZ_CP156768
Coordinates   2743412..2743864 (-) Length   150 a.a.
NCBI ID   WP_347454473.1    Uniprot ID   -
Organism   Acinetobacter thermotolerans strain ANC 7974     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2721356..2772338 2743412..2743864 within 0


Gene organization within MGE regions


Location: 2721356..2772338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEF83_RS13375 (ABEF83_13375) - 2721356..2722585 (-) 1230 WP_347454984.1 transposase -
  ABEF83_RS13380 (ABEF83_13380) - 2722924..2724153 (-) 1230 WP_347454121.1 MFS transporter -
  ABEF83_RS13385 (ABEF83_13385) - 2724325..2724699 (-) 375 WP_347454460.1 hypothetical protein -
  ABEF83_RS13390 (ABEF83_13390) - 2724850..2726259 (-) 1410 WP_347454120.1 FAD-binding oxidoreductase -
  ABEF83_RS13395 (ABEF83_13395) serA 2726614..2727846 (+) 1233 WP_034587753.1 phosphoglycerate dehydrogenase -
  ABEF83_RS13400 (ABEF83_13400) - 2728026..2728844 (+) 819 Protein_2586 EamA family transporter -
  ABEF83_RS13405 (ABEF83_13405) - 2728849..2729166 (-) 318 WP_347454461.1 hypothetical protein -
  ABEF83_RS13410 (ABEF83_13410) tnpA 2729321..2729734 (-) 414 Protein_2588 IS200/IS605 family transposase -
  ABEF83_RS13415 (ABEF83_13415) - 2729755..2730812 (+) 1058 Protein_2589 RNA-guided endonuclease InsQ/TnpB family protein -
  ABEF83_RS13420 (ABEF83_13420) - 2730809..2731402 (-) 594 WP_347454462.1 hypothetical protein -
  ABEF83_RS13425 (ABEF83_13425) - 2731448..2731621 (-) 174 WP_347454463.1 hypothetical protein -
  ABEF83_RS13430 (ABEF83_13430) - 2731744..2732895 (-) 1152 WP_347454464.1 hypothetical protein -
  ABEF83_RS13435 (ABEF83_13435) - 2733139..2734015 (+) 877 Protein_2593 IS982-like element ISAba825 family transposase -
  ABEF83_RS13440 (ABEF83_13440) - 2734199..2735077 (+) 879 WP_347453527.1 EamA family transporter -
  ABEF83_RS13445 (ABEF83_13445) - 2735149..2735562 (+) 414 WP_347454465.1 hypothetical protein -
  ABEF83_RS13450 (ABEF83_13450) - 2735617..2736084 (-) 468 WP_347454466.1 hemerythrin domain-containing protein -
  ABEF83_RS13455 (ABEF83_13455) - 2736212..2736979 (-) 768 WP_347454467.1 TSUP family transporter -
  ABEF83_RS13460 (ABEF83_13460) truB 2737002..2737907 (-) 906 WP_347454468.1 tRNA pseudouridine(55) synthase TruB -
  ABEF83_RS13465 (ABEF83_13465) - 2738063..2739094 (+) 1032 WP_347454469.1 lipase secretion chaperone -
  ABEF83_RS13470 (ABEF83_13470) - 2739630..2740613 (+) 984 WP_404798936.1 lipase family alpha/beta hydrolase -
  ABEF83_RS13475 (ABEF83_13475) rplS 2740675..2741046 (-) 372 WP_004787066.1 50S ribosomal protein L19 -
  ABEF83_RS13480 (ABEF83_13480) trmD 2741223..2741972 (-) 750 WP_347454471.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ABEF83_RS13485 (ABEF83_13485) rimM 2742014..2742562 (-) 549 WP_347453520.1 ribosome maturation factor RimM -
  ABEF83_RS13490 (ABEF83_13490) rpsP 2742592..2742849 (-) 258 WP_034587736.1 30S ribosomal protein S16 -
  ABEF83_RS13495 (ABEF83_13495) - 2742975..2743418 (-) 444 WP_347454472.1 type IV pilin protein -
  ABEF83_RS13500 (ABEF83_13500) comE 2743412..2743864 (-) 453 WP_347454473.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  ABEF83_RS13505 (ABEF83_13505) - 2743875..2747792 (-) 3918 WP_347454474.1 PilC/PilY family type IV pilus protein -
  ABEF83_RS13510 (ABEF83_13510) - 2747812..2748585 (-) 774 WP_347454475.1 pilus assembly protein -
  ABEF83_RS13515 (ABEF83_13515) - 2748586..2749554 (-) 969 WP_347454476.1 PilW family protein -
  ABEF83_RS13520 (ABEF83_13520) pilV 2749554..2750105 (-) 552 WP_347454477.1 type IV pilus modification protein PilV -
  ABEF83_RS13525 (ABEF83_13525) - 2750108..2750593 (-) 486 WP_347454478.1 GspH/FimT family pseudopilin -
  ABEF83_RS13530 (ABEF83_13530) ispH 2750757..2751707 (-) 951 WP_347454479.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  ABEF83_RS13535 (ABEF83_13535) gmk 2751842..2752465 (+) 624 WP_347453512.1 guanylate kinase -
  ABEF83_RS13540 (ABEF83_13540) rpoZ 2752540..2752821 (+) 282 WP_034587719.1 DNA-directed RNA polymerase subunit omega -
  ABEF83_RS13545 (ABEF83_13545) - 2753034..2755136 (+) 2103 WP_347454480.1 HD domain-containing protein -
  ABEF83_RS13550 (ABEF83_13550) - 2755212..2755595 (+) 384 WP_347454481.1 RidA family protein -
  ABEF83_RS13555 (ABEF83_13555) - 2755784..2755978 (+) 195 WP_347453509.1 bacterioferritin-associated ferredoxin -
  ABEF83_RS13560 (ABEF83_13560) bfr 2756218..2756682 (+) 465 WP_347454482.1 bacterioferritin -
  ABEF83_RS13565 (ABEF83_13565) - 2756750..2758384 (-) 1635 WP_347454483.1 Wzy polymerase domain-containing protein -
  ABEF83_RS13570 (ABEF83_13570) - 2758472..2759650 (+) 1179 WP_347454484.1 glycosyltransferase family 4 protein -
  ABEF83_RS13575 (ABEF83_13575) - 2759647..2760675 (+) 1029 WP_347454485.1 glycosyltransferase family 4 protein -
  ABEF83_RS13580 (ABEF83_13580) - 2760676..2761761 (-) 1086 WP_347454486.1 glycosyltransferase family 1 protein -
  ABEF83_RS13585 (ABEF83_13585) - 2761899..2763278 (-) 1380 WP_347454487.1 glycosyltransferase family 1 protein -
  ABEF83_RS13590 (ABEF83_13590) - 2763343..2764230 (-) 888 WP_347454488.1 NAD-dependent epimerase/dehydratase family protein -
  ABEF83_RS13595 (ABEF83_13595) gmd 2764250..2765284 (-) 1035 WP_347454489.1 GDP-mannose 4,6-dehydratase -
  ABEF83_RS13600 (ABEF83_13600) - 2765494..2766918 (-) 1425 WP_347454490.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  ABEF83_RS13605 (ABEF83_13605) - 2767056..2767757 (-) 702 WP_347454491.1 class I SAM-dependent methyltransferase -
  ABEF83_RS13610 (ABEF83_13610) - 2767770..2769488 (-) 1719 WP_347454492.1 ABC transporter ATP-binding protein -
  ABEF83_RS13615 (ABEF83_13615) - 2769492..2770340 (-) 849 WP_347454493.1 glycosyltransferase family 2 protein -
  ABEF83_RS13620 (ABEF83_13620) - 2770512..2772338 (-) 1827 WP_347454494.1 hypothetical protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17034.39 Da        Isoelectric Point: 5.2667

>NTDB_id=1002561 ABEF83_RS13500 WP_347454473.1 2743412..2743864(-) (comE) [Acinetobacter thermotolerans strain ANC 7974]
MQDSKGFTLIELMIVVVILAIIAAIAIPSYKETIRKNNEAKAQQEILKVAEQLERYRARNFNYRNFTATNVILPDGYSLN
IYDLDSTNKGLGDGVQGRGWFIKVEPPTDPKNYYFLMSSTGLKCKSRLESDVDFKCEPWDDSAQTGSQPW

Nucleotide


Download         Length: 453 bp        

>NTDB_id=1002561 ABEF83_RS13500 WP_347454473.1 2743412..2743864(-) (comE) [Acinetobacter thermotolerans strain ANC 7974]
ATGCAGGATAGCAAAGGTTTCACCTTGATTGAGCTAATGATTGTGGTGGTGATCCTTGCGATCATTGCTGCAATCGCTAT
ACCAAGCTATAAGGAAACCATCAGGAAAAATAATGAGGCGAAAGCTCAGCAGGAAATATTAAAAGTTGCTGAGCAATTAG
AACGGTATCGTGCCAGAAATTTTAATTATCGAAATTTCACTGCCACGAATGTGATACTTCCTGATGGATATAGTTTAAAT
ATCTATGATTTAGATAGTACCAATAAAGGGTTAGGTGATGGAGTTCAAGGACGAGGATGGTTTATTAAAGTAGAGCCGCC
AACCGATCCTAAAAACTATTATTTTCTTATGAGTAGCACAGGTTTAAAGTGTAAATCACGTTTAGAGAGTGATGTGGATT
TTAAATGTGAGCCTTGGGATGATAGTGCACAAACAGGAAGTCAGCCATGGTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-73)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Acinetobacter baylyi ADP1

42.69

100

0.487
  pilY2 Acinetobacter baumannii D1279779

40.26

100

0.413

Multiple sequence alignment