Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ABFY42_RS16150 Genome accession   NZ_CP156682
Coordinates   3232875..3233015 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain B115     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3227875..3238015
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFY42_RS16125 (ABFY42_16125) - 3228215..3228598 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  ABFY42_RS16130 (ABFY42_16130) comA 3228620..3229264 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  ABFY42_RS16135 (ABFY42_16135) comP 3229345..3231636 (-) 2292 WP_022553709.1 histidine kinase Regulator
  ABFY42_RS16140 (ABFY42_16140) comX 3231648..3231812 (-) 165 WP_007613432.1 competence pheromone ComX -
  ABFY42_RS16145 (ABFY42_16145) - 3231812..3232690 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  ABFY42_RS16150 (ABFY42_16150) degQ 3232875..3233015 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ABFY42_RS16155 (ABFY42_16155) - 3233472..3233813 (+) 342 WP_014418765.1 hypothetical protein -
  ABFY42_RS16160 (ABFY42_16160) - 3233820..3235043 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  ABFY42_RS16165 (ABFY42_16165) - 3235173..3236639 (-) 1467 WP_233922936.1 nicotinate phosphoribosyltransferase -
  ABFY42_RS16170 (ABFY42_16170) - 3236657..3237208 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  ABFY42_RS16175 (ABFY42_16175) - 3237305..3237703 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1002115 ABFY42_RS16150 WP_003152043.1 3232875..3233015(-) (degQ) [Bacillus velezensis strain B115]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1002115 ABFY42_RS16150 WP_003152043.1 3232875..3233015(-) (degQ) [Bacillus velezensis strain B115]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment