Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 200002 |
| Name | oriT_Tn1549  |
| Organism | Enterococcus faecalis |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | AF192329 (22239..22266 [+], 28 nt) |
| oriT length | 28 nt |
| IRs (inverted repeats) | 1..7, 12..18 (GGGAGTG..CACTCCC) |
| Location of nic site | 26..27 |
| Conserved sequence flanking the nic site |
RYGCTTG|C |
| Note | The RYGCTTG|C cleavage motif conserved in rolling-circle replicating (RCR) plasmids such as pNZ4000 of Lactococcus lactis and pC221 and pC223 of Staphylococcus aureus. The minimal oriT contained an inverted repeat and a core,which was homologous to the cleavage sequence found in certain Gram-positive rolling-circle replicating(RCR) plasmids. |
oriT sequence
Download Length: 28 nt
GGGAGTGGCTACACTCCCTATGCTTGCT
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Tsvetkova K et al. (2010) Analysis of the mobilization functions of the vancomycin resistance transposon Tn1549, a member of a new family of conjugative elements. J Bacteriol. 192(3):702-13. [PMID:19966009]
Relaxosome
This oriT is a component of a relaxosome.
| Relaxosome name | RelaxosomeTn1549  |
| oriT | oriT_Tn1549 |
| Relaxase | Orf28_Tn1549 (MOBP) |
| Auxiliary protein | Orf29_Tn1549 |
Reference
[1] Tsvetkova K et al. (2010) Analysis of the mobilization functions of the vancomycin resistance transposon Tn1549, a member of a new family of conjugative elements. J Bacteriol. 192(3):702-13. [PMID:19966009]
[2] Grohmann E et al. (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193]
Relaxase
| ID | 216 | GenBank | AAF72355 |
| Name | Orf28_Tn1549 |
UniProt ID | Q9L8Y8 |
| Length | 442 a.a. | PDB ID | |
| Note | Rlx-like protein | ||
Relaxase protein sequence
Download Length: 442 a.a. Molecular weight: 50173.57 Da Isoelectric Point: 9.6754
MAVTKIHPIKSTLKKALDYIENPDKTDGKLLVASFACSYETADIEFEMLLAQAYQKGNNLGHHLIQSFAP
GEATPEQAHEIGKQLAEEVLQGKYPYVLTTHIDKGHVHNHIIFCAVDMVNQRKYISNKQSYAYIRRTSDR
LCKENGLSVVKPGQSKGKSYAEWDAQRKGTSWKAKLKAAIDAAIPQAKDFDDFLRLMQAQGYEIKPGKFI
SFRAPGQERFTRCKTLGEAYTEEAIKERIKGRVITRAPKERKGISLRIDLENNIKAQQSAGYERWAKLHN
LKQAAKTLNFLTEHGIDTYPDLESKVAEITAASDEAAATLKAMEHRLADMAVLIKNISTYKQLWPVAMEY
RNAADKAKFRREHESTLILYEAAAKALKGQGVKKLPDLYALKAEYKRLAEEKERLYEKYGEAKKQMQEYG
IIKQNVDGILRMTPGKEWTQEL
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9L8Y8 |
Reference
[1] Grohmann E et al. (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193]
Auxiliary protein
| ID | 304 | GenBank | AAF72356 |
| Name | Orf29_Tn1549 |
UniProt ID | Q9L8Y7 |
| Length | 109 a.a. | PDB ID | _ |
| Note | Orf29 was a mobilization accessory component similar to MobC proteins | ||
Auxiliary protein sequence
Download Length: 109 a.a. Molecular weight: 12486.63 Da Isoelectric Point: 10.5610
MANRKRKIVLRVPVTPEERAMIEQKMALLHTKNFSAYARKMLIDGYIVNMDTSDIRAQTAEIQKIGVNVN
QIAKRLNGMGPVYAQDIEDIKGALAQIWQLQRYILSSQR
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9L8Y7 |
Reference
[1] Tsvetkova K et al. (2010) Analysis of the mobilization functions of the vancomycin resistance transposon Tn1549, a member of a new family of conjugative elements. J Bacteriol. 192(3):702-13. [PMID:19966009]
Host bacterium
| ID | 7 | Element type | ICE (Integrative and conjugative element) |
| Element name | Tn1549 | GenBank | AF192329 |
| Element size | 33805 bp | Coordinate of oriT [Strand] | 22239..22266 [+] |
| Host bacterium | Enterococcus faecalis |
Cargo genes
| Drug resistance gene | VanHBX |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |