Detailed information of auxiliary protein

Auxiliary protein


ID   304 GenBank   AAF72356
Name   Orf29_Tn1549 experimental UniProt ID   Q9L8Y7
Length   109 a.a. PDB ID   _
Note   Orf29 was a mobilization accessory component similar to MobC proteins

  Protein sequence


Download         Length: 109 a.a.        Molecular weight: 12486.63 Da        Isoelectric Point: 10.5610

>AAF72356.1 unknown (plasmid) [Enterococcus faecalis]
MANRKRKIVLRVPVTPEERAMIEQKMALLHTKNFSAYARKMLIDGYIVNMDTSDIRAQTAEIQKIGVNVN
QIAKRLNGMGPVYAQDIEDIKGALAQIWQLQRYILSSQR

  Protein domains


Predicted by InterproScan

(60-99)

  Protein structure


Source ID Structure
AlphaFold DB Q9L8Y7

  Reference


[1] Tsvetkova K et al. (2010) Analysis of the mobilization functions of the vancomycin resistance transposon Tn1549, a member of a new family of conjugative elements. J Bacteriol. 192(3):702-13. [PMID:19966009]