Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101015
Name   oriT_pWBG749 experimental
Organism   Staphylococcus aureus
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_013327 (28147..28335 [-], 189 nt)
oriT length   189 nt
IRs (inverted repeats)      IR1: 132..138, 142..148  (GTCTGGC..GCCAGAC)
  IR2: 149..155, 162..168  (CTATCAT..ATGATAG)
  IR3: 127..131, 172..176  (GGAAT..ATTCC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   (1) oriT_pWBG749-like sequences are found on 53% of Staphylococcus aureus plasmid sequences [PMID:26243776].
 (2) oriT_pWBG749 can divided into five subfamilies according to its IR2 sequences [PMID:26243776].
 (3) Mobilization from pWBG749 family plasmid is specific for matching IR2 sequences [PMID:26243776].
 (4) SmpO auxiliary protein binds ossA and ossB of oriT_pWBG749 [PMID:33939800].
 (5) An F7K amino substitution of SmpO auxiliary protein switched oriT-binding specificity in vitro and reduced the self-transfer of pWBG749 in vivo [PMID:33939800].

  oriT sequence  


Download         Length: 189 nt

>oriT_pWBG749
TGTCACAAAAATAAGACAAAATCTACATGTAGTGTCACAAAACCGTGACATACACAATATATAGTGTCACAAAAATGTGACACTAGGTGTTTTTATGATATCACTATGAAATGTCCTAAAACCCTTGGAATGTCTGGCTTTGCCAGACCTATCATTGTCCGATGATAGCAAATTCCCCTTATGCTCTTA

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Frances G O'Brien et al. (2015) Origin-of-transfer sequences facilitate mobilisation of non-conjugative antimicrobial-resistance plasmids in Staphylococcus aureus. Nucleic acids research. 43(16):7971-83. [PMID:26243776]


Relaxosome

This oriT is a component of a relaxosome.

Relaxosome name   RelaxosomepWBG749 in_silico
oriT   oriT_pWBG749 experimental
Relaxase   SmpP experimental (MOBP)
Auxiliary protein   SmpO experimental

  Reference


[1] Frances G O'Brien et al. (2015) Origin-of-transfer sequences facilitate mobilisation of non-conjugative antimicrobial-resistance plasmids in Staphylococcus aureus. Nucleic acids research. 43(16):7971-83. [PMID:26243776]


Relaxase

ID   1078 GenBank   ACZ58779
Name   SmpP experimental UniProt ID   D2J7N0
Length   382 a.a. PDB ID   
Note   

  Relaxase protein sequence


Download         Length: 382 a.a.        Molecular weight: 45704.95 Da        Isoelectric Point: 9.8997

>ACZ58779.1 hypothetical protein SAP031A_037 (plasmid) [Staphylococcus aureus]
MPKIVTVSQFEQPNEFYEYSNYVNYMKRGEAQNNKDDFKYDVYAHYMFDEEKSQNMFNEYDNFMSKKAIN
KIKSDFSHAQKNKGMMWKDVISFDNSALESVGIYDSKTHTLDEQKIKEATRKMMKRFEKKEGLEENLVWS
GAIHYNTDNIHVHVAAVEKVIKRTRGKRKPATLKHMKSTFANELFDIKGERQKINDFIRERIVKGIRDES
EPCKDKAMKKQIKKVHKLLEDIPRNQWNYNNNILKYIRPEIDKITDIYIKNYHSKDFEVFKNDLKRQTNL
YKETYGENSNYGSYEKTKMKDLYARSGNTILKNIKELDQDLMKVKQQSTHSKSNATITKLKIGKCLNQAL
YRTKYALRSDYDKEKNIQQYYQEFDKQSYRER

  Protein domains


Predicted by InterproScan.

MobL relaxases (MobL)

(1-357)


  Protein structure


Source ID Structure
AlphaFold DB D2J7N0

  Reference


[1] Frances G O'Brien et al. (2015) Origin-of-transfer sequences facilitate mobilisation of non-conjugative antimicrobial-resistance plasmids in Staphylococcus aureus. Nucleic acids research. 43(16):7971-83. [PMID:26243776]


Auxiliary protein

ID   388 GenBank   WP_012816542
Name   SmpO experimental UniProt ID   D2J7N1
Length   84 a.a. PDB ID   _
Note   (1) SmpO auxiliary protein binds ossA and ossB of oriTpWBG749 [PMID:33939800].
 (2) An F7K amino substitution of SmpO auxiliary protein switched oriT-binding specificity in vitro and reduced the self-transfer of pWBG749 in vivo [PMID:33939800].

  Auxiliary protein sequence


Download         Length: 84 a.a.        Molecular weight: 9898.20 Da        Isoelectric Point: 5.1035

>WP_012816542.1 hypothetical protein [Staphylococcus aureus]
MPTKDIFIRNVNVDTLERIDRLAKQKNISRNDFLLGIIEQVDPLECYRSLYAEQSHQQAQNTKALKELAD
KIDRVYNTINDLEY

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB D2J7N1

  Reference


[1] Frances G O'Brien et al. (2015) Origin-of-transfer sequences facilitate mobilisation of non-conjugative antimicrobial-resistance plasmids in Staphylococcus aureus. Nucleic acids research. 43(16):7971-83. [PMID:26243776]


Host bacterium

ID   1476 GenBank   NC_013327
Plasmid name   pWBG749 Incompatibility group   -
Plasmid size   38087 bp Coordinate of oriT [Strand]   28147..28335 [-]
Host baterium   Staphylococcus aureus

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21, AcrIIA14